(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE475

PENCW_16.PE475       Location/Qualifiers
FT   CDS             join(complement(1072920..1073193),
FT                   complement(1072712..1072821))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129270"
FT                   /orf_name="Pc20g04750"
FT                   /product="Putative uncharacterized protein Pc20g04750 "
FT                   /protein_id="CAP85804.1"
FT                   /db_xref="UniParc:UPI000183176D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE45"
FT                   /transl_table=1
FT                   /translation="MAWLSVQDDLRISPAWSVPDVLQVSRRFYPLRVFLSPGRSFPKFE
FT                   GRVTVAHVIGCYVISAPSRYGLTFLPWFHPWITLFKTTLKNGIGVLSNYTRIITEPVYS
FT                   NGLALTRALWATTTVACAHRSVV"
     MAWLSVQDDL RISPAWSVPD VLQVSRRFYP LRVFLSPGRS FPKFEGRVTV AHVIGCYVIS        60
     APSRYGLTFL PWFHPWITLF KTTLKNGIGV LSNYTRIITE PVYSNGLALT RALWATTTVA       120
     CAHRSVV                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page