(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE478

PENCW_16.PE478       Location/Qualifiers
FT   CDS             join(complement(1079873..1080252),
FT                   complement(1079574..1079817))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978102"
FT                   /orf_name="Pc20g04780"
FT                   /product="Pc20g04780 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85807.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831841"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE86"
FT                   /transl_table=1
FT                   /translation="MQSPFSYPDSYSSSYSSSPGTMDFFFYGGQPVYDTLCDLDTTTSF
FT                   PMQEVTPEVYGITSSPYTYQRPQDFPVFERPVMPQSAPSSCGSSYSSSYSSSFNFPSED
FT                   VSLPSYPISEYEPSADSPAPASKPVKPFGCDHCGRAFTRFADLKRHQSSVHYPVFRNCP
FT                   VEHCSRKGSNGFPRQDHLVEHLRSYHHLDVPKRGSCKRSAKQMS"
     MQSPFSYPDS YSSSYSSSPG TMDFFFYGGQ PVYDTLCDLD TTTSFPMQEV TPEVYGITSS        60
     PYTYQRPQDF PVFERPVMPQ SAPSSCGSSY SSSYSSSFNF PSEDVSLPSY PISEYEPSAD       120
     SPAPASKPVK PFGCDHCGRA FTRFADLKRH QSSVHYPVFR NCPVEHCSRK GSNGFPRQDH       180
     LVEHLRSYHH LDVPKRGSCK RSAKQMS                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page