(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE479

PENCW_16.PE479       Location/Qualifiers
FT   CDS             join(complement(1084013..1084267),
FT                   complement(1082455..1083932),complement(1082319..1082379))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949965"
FT                   /orf_name="Pc20g04790"
FT                   /product="Pc20g04790 protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85808.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="UniParc:UPI0001831842"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE87"
FT                   /transl_table=1
FT                   /translation="MAARKTQQEIEKTFKKVSEGIQTFEGIYEKIRQATNPTQRDKLED
FT                   HLKREIKKLQRFRDQIKSWAAGNEVKDKAPLMEQRKAIEVCMEQFKAVEKEMKTKAYSK
FT                   EGLSAASRLDPKEKERVECSEFLSNMVDELQLKIEALEAEEETLHAQMKKGKKDTKKAD
FT                   RMADISHVTERHKWHVNKLEFLNRSLQNGNLDVGAVQDLKESIKYYVEEGGSPDYSGED
FT                   ETLYDDLNIGDDVEAQFGMGGDGDRVSSQDAQSVQDEEPEAKPKAKQEGPAARRPSTQM
FT                   KSPLPVLATLHPSASSSATPGMKPAPLPTRPPGETLKYASAAAAAAASDKSGVGILPLP
FT                   PPPGFSPALSVSLPVPKSSTASPSVASAQPVTKSIIPPTVAAVTEELSGPARSKAPVSG
FT                   NVSSPAPAKMETSTNGKPETEGTESEESVYHLPPGLQDLLQSFEVTKSRASANPSPSVQ
FT                   RLLATSLTTCPEAGDAEKPRHYKPQNPYSTALYYPQEPLSIFDDPRLYDTGRIDTDTLF
FT                   YLFYYRQGTYQQYLAAKALRNQSWRFHKQYQTWFQRHEEPKNITEEFEQGTYRFFDYES
FT                   TWMNRRKADFKFVYKYLEDEL"
     MAARKTQQEI EKTFKKVSEG IQTFEGIYEK IRQATNPTQR DKLEDHLKRE IKKLQRFRDQ        60
     IKSWAAGNEV KDKAPLMEQR KAIEVCMEQF KAVEKEMKTK AYSKEGLSAA SRLDPKEKER       120
     VECSEFLSNM VDELQLKIEA LEAEEETLHA QMKKGKKDTK KADRMADISH VTERHKWHVN       180
     KLEFLNRSLQ NGNLDVGAVQ DLKESIKYYV EEGGSPDYSG EDETLYDDLN IGDDVEAQFG       240
     MGGDGDRVSS QDAQSVQDEE PEAKPKAKQE GPAARRPSTQ MKSPLPVLAT LHPSASSSAT       300
     PGMKPAPLPT RPPGETLKYA SAAAAAAASD KSGVGILPLP PPPGFSPALS VSLPVPKSST       360
     ASPSVASAQP VTKSIIPPTV AAVTEELSGP ARSKAPVSGN VSSPAPAKME TSTNGKPETE       420
     GTESEESVYH LPPGLQDLLQ SFEVTKSRAS ANPSPSVQRL LATSLTTCPE AGDAEKPRHY       480
     KPQNPYSTAL YYPQEPLSIF DDPRLYDTGR IDTDTLFYLF YYRQGTYQQY LAAKALRNQS       540
     WRFHKQYQTW FQRHEEPKNI TEEFEQGTYR FFDYESTWMN RRKADFKFVY KYLEDEL          597
//

If you have problems or comments...

PBIL Back to PBIL home page