(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE48

PENCW_16.PE48        Location/Qualifiers
FT   CDS             join(108359..108413,108485..108624,108677..108805,
FT                   108866..109105)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128434"
FT                   /orf_name="Pc20g00480"
FT                   /product="Pc20g00480 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85377.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015602"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI0001831AB3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN7"
FT                   /transl_table=1
FT                   /translation="MPSAPKQRKIAIVGSRSVGKSSLTVRFVEHHFVESYYPTIENTFS
FT                   RIIKHNGQDYATEIVDTAGQDEYSILNSKHFIGIHGYIIVYSVTSRQSFDMVRVIRDKI
FT                   LNHLGADDVPLVIVGNKSDLKPDHRQVTLDDGRQLAEELNCAFTEASAFLDFNVSKAFD
FT                   LMIGEVEKSQNPSQPTGNNKCALM"
     MPSAPKQRKI AIVGSRSVGK SSLTVRFVEH HFVESYYPTI ENTFSRIIKH NGQDYATEIV        60
     DTAGQDEYSI LNSKHFIGIH GYIIVYSVTS RQSFDMVRVI RDKILNHLGA DDVPLVIVGN       120
     KSDLKPDHRQ VTLDDGRQLA EELNCAFTEA SAFLDFNVSK AFDLMIGEVE KSQNPSQPTG       180
     NNKCALM                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page