(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE480

PENCW_16.PE480       Location/Qualifiers
FT   CDS             join(1084791..1084797,1084850..1085028,1085080..1085122,
FT                   1085184..1085410,1085478..1085609)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949966"
FT                   /orf_name="Pc20g04800"
FT                   /product="Pc20g04800 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="D-amino acid catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85809.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="GO:0019478"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="UniParc:UPI0001831843"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE88"
FT                   /transl_table=1
FT                   /translation="MKLVIQRVKSASVTVDSELISSIGKGLLVFAGVGKEDTEKDAENL
FT                   VNKVLKAKFWPDENGVQWKKNVKDIEGEVLCVSQFTLYAKMKKGNKPDFHDAAAPEPAR
FT                   KLYDFFYAKMGEGYTPDRVKNGVFQAMMDVELKNDGPVGVNYCSEDAAVTIEINTNLPK
FT                   KEPKEQQNGDKKTDEQEIKGSFEFQIPPELLQ"
     MKLVIQRVKS ASVTVDSELI SSIGKGLLVF AGVGKEDTEK DAENLVNKVL KAKFWPDENG        60
     VQWKKNVKDI EGEVLCVSQF TLYAKMKKGN KPDFHDAAAP EPARKLYDFF YAKMGEGYTP       120
     DRVKNGVFQA MMDVELKNDG PVGVNYCSED AAVTIEINTN LPKKEPKEQQ NGDKKTDEQE       180
     IKGSFEFQIP PELLQ                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page