(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE481

PENCW_16.PE481       Location/Qualifiers
FT   CDS             join(1085871..1085886,1085956..1086020,1086083..1086092,
FT                   1086147..1086233,1086297..1087237)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949967"
FT                   /orf_name="Pc20g04810"
FT                   /product="Pc20g04810 protein"
FT                   /function="binding"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP85810.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI0001831844"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE89"
FT                   /transl_table=1
FT                   /translation="MATAQRSRVFFDIKIGDSKPSRVAFELFNDVVPKTADNFRALCTG
FT                   EKGIGTQGKELTYKGSIFHRVIKQFMIQGGDFTAFNGTGGESIYGEKFPDENFDLKHDR
FT                   PFLLSMANSGPGTNGSQFFVTTVPTPHLDGKHVVFGEVINGKSVIRKIENVKTQSDKPF
FT                   QDVTIVDCGELSGEDYENATKRQQDATGDPYEDFTEDHQGEELTAPLCFKIASDLKGFG
FT                   NTAFKSGDLDLGLDKYQKGLRYLNEFPDPGENDPKELGEQMKALRFTLHSNSSLLANKL
FT                   QKYRQAQNWATYALQVADSANAKDADKAKAYYRRAVAHGGLKEEEEALKDLQEAEKLAP
FT                   GDAGILNEIAKVKKTVKDREAKDKAAAKKFFS"
     MATAQRSRVF FDIKIGDSKP SRVAFELFND VVPKTADNFR ALCTGEKGIG TQGKELTYKG        60
     SIFHRVIKQF MIQGGDFTAF NGTGGESIYG EKFPDENFDL KHDRPFLLSM ANSGPGTNGS       120
     QFFVTTVPTP HLDGKHVVFG EVINGKSVIR KIENVKTQSD KPFQDVTIVD CGELSGEDYE       180
     NATKRQQDAT GDPYEDFTED HQGEELTAPL CFKIASDLKG FGNTAFKSGD LDLGLDKYQK       240
     GLRYLNEFPD PGENDPKELG EQMKALRFTL HSNSSLLANK LQKYRQAQNW ATYALQVADS       300
     ANAKDADKAK AYYRRAVAHG GLKEEEEALK DLQEAEKLAP GDAGILNEIA KVKKTVKDRE       360
     AKDKAAAKKF FS                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page