(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE482

PENCW_16.PE482       Location/Qualifiers
FT   CDS             join(complement(1089126..1089200),
FT                   complement(1089057..1089075),complement(1088696..1088984),
FT                   complement(1088360..1088636),complement(1087727..1088305))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000080362" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949968"
FT                   /orf_name="Pc20g04820"
FT                   /product="Pc20g04820 protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /protein_id="CAP85811.1"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniParc:UPI0001831845"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE90"
FT                   /transl_table=1
FT                   /translation="MGIKGIRTALKVDLNKLAREQPGLHNRWHPDVPSYGKIVNNEVVK
FT                   IECLDWTGGQIGNNDSADDIKNVDLTQIHYLSGPFDIETAEPGDVLLVEIQDVQPFEEQ
FT                   PWGFSGVFHKENGGGFLDHLYPEAAKAIWDFEGIFCSSRHIPHVRFAGLIHPGILGCAP
FT                   SAEVLAEWNRREGELIATNTVADRIVAQPPNPRNAHSGHATDEVKNKIANEGARTIPGR
FT                   PEHGGNCDIKNLSRGSKVYLPVHVPGAKFSVGDLHFSQGDGEISFCGAIEMAGVITLKF
FT                   TVIKNGMAKLDMKSPIFHAGPVEPQFGPGRYLTFEGFSVDENGKQHFLDATVAYRQTCL
FT                   RVIEYLRRYGYSDYQIYLLLSCAPVQGHIAGIVDIPNACTTLSVPMDIFDFDIRPEADV
FT                   VKKDMGACAFVTK"
     MGIKGIRTAL KVDLNKLARE QPGLHNRWHP DVPSYGKIVN NEVVKIECLD WTGGQIGNND        60
     SADDIKNVDL TQIHYLSGPF DIETAEPGDV LLVEIQDVQP FEEQPWGFSG VFHKENGGGF       120
     LDHLYPEAAK AIWDFEGIFC SSRHIPHVRF AGLIHPGILG CAPSAEVLAE WNRREGELIA       180
     TNTVADRIVA QPPNPRNAHS GHATDEVKNK IANEGARTIP GRPEHGGNCD IKNLSRGSKV       240
     YLPVHVPGAK FSVGDLHFSQ GDGEISFCGA IEMAGVITLK FTVIKNGMAK LDMKSPIFHA       300
     GPVEPQFGPG RYLTFEGFSV DENGKQHFLD ATVAYRQTCL RVIEYLRRYG YSDYQIYLLL       360
     SCAPVQGHIA GIVDIPNACT TLSVPMDIFD FDIRPEADVV KKDMGACAFV TK               412
//

If you have problems or comments...

PBIL Back to PBIL home page