(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE483

PENCW_16.PE483       Location/Qualifiers
FT   CDS             join(complement(1091115..1091172),
FT                   complement(1090755..1090861),complement(1090527..1090699),
FT                   complement(1090079..1090472),complement(1089672..1090028))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949969"
FT                   /orf_name="Pc20g04830"
FT                   /product="Pc20g04830 protein"
FT                   /biological_process="cysteine biosynthetic process "
FT                   /cellular_component="Gram-negative-bacterium-type cell wall"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85812.1"
FT                   /db_xref="GO:0009276"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0019344"
FT                   /db_xref="InterPro:IPR007496"
FT                   /db_xref="UniParc:UPI0001831846"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE91"
FT                   /transl_table=1
FT                   /translation="MSNFEPNAVIRGFQLTVVGTVRALANPELFKYDHFRQAALAIAIG
FT                   TVIQLIIQIPIFSVKFSIYILSWVVNLEQAVWDDKLLNGLEFMSKSVLQVPFLLMTLMR
FT                   YVTPTLDEIFMQSIQWVDTTYIQKHKSEDPRQLRSLYYPNLVQYSTKGGSSVSRSIPEA
FT                   LRSFFNRYAKKIGMMLGLYLLSMVVIIGRFVMPAASFYTFRSHVGSTPAAVIFGVGLFL
FT                   PKKYIVTFLHTYFASRSLMRELLEPYFWRIKFTPEQKRRWFRDREGVLFGFAFAFTVLL
FT                   RIPYIGVLMYGVAEASTAYLVTKITDPPPPPAESTNFAESQVTWRNKHDFLRLSLDNLD
FT                   KLNVDTVERDDKDSGSPGKKFS"
     MSNFEPNAVI RGFQLTVVGT VRALANPELF KYDHFRQAAL AIAIGTVIQL IIQIPIFSVK        60
     FSIYILSWVV NLEQAVWDDK LLNGLEFMSK SVLQVPFLLM TLMRYVTPTL DEIFMQSIQW       120
     VDTTYIQKHK SEDPRQLRSL YYPNLVQYST KGGSSVSRSI PEALRSFFNR YAKKIGMMLG       180
     LYLLSMVVII GRFVMPAASF YTFRSHVGST PAAVIFGVGL FLPKKYIVTF LHTYFASRSL       240
     MRELLEPYFW RIKFTPEQKR RWFRDREGVL FGFAFAFTVL LRIPYIGVLM YGVAEASTAY       300
     LVTKITDPPP PPAESTNFAE SQVTWRNKHD FLRLSLDNLD KLNVDTVERD DKDSGSPGKK       360
     FS                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page