(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE484

PENCW_16.PE484       Location/Qualifiers
FT   CDS             1091509..1093689
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129271"
FT                   /orf_name="Pc20g04840"
FT                   /product="Pc20g04840 protein"
FT                   /protein_id="CAP85813.1"
FT                   /db_xref="UniParc:UPI0001831847"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE92"
FT                   /transl_table=1
FT                   /translation="MPESPSELGQIQSLRRSLTLPTKLNPLAQRRSSVPNTPEHVIFYH
FT                   PSAKIVHFSPRALAPIPSSSAPSDFDYPVDTIETLPWRSATERTVATAPLRLEKVHGST
FT                   AFLKCGNVVHAILKNSQCWCVDGVSKFVLRIRPLTYYRIEIPYETEDERSLVRDLKIAL
FT                   PTVLRYEVTPCPFKRAFSVELPSDAMAPRRKKAWQPKDRRERVPTVLEPRRETPSPSSI
FT                   RSDCIDSASTGDDTDGNLTDDSCFTSNKANSTVLETIPDDRESSPVEALSPSPYLGPPR
FT                   RSVSETPQTFTSLLAKFEATSVAENDQDSELVLKPEYASRADVVPEIDHELKVAEQLEP
FT                   EFLADGVEAGPGSETVLDAESKTAAQPGDKPEHDPEAILHAGRSSEAAVKEEPIISAET
FT                   DAALAAETSEEAVFRAEPTTAVEAEAVPEGNVMNVEGVQIIQPAAEPTLDIDHDASFAS
FT                   NPESFHSAEPHSPDSVSTHPTSVGGHELPESEEKFNISSTNHIISGYESAPADPCKTSQ
FT                   PPTLNIPQSDHASNQTSLPGPPLVHGTSSNNLPRRFADAFSDTSPSMAPTSNENPPSRS
FT                   TDASSDTHMRPSVHAKAAPLNTDFDHMSAEFRRRSKATRERDVSPMPHSSALYQPSGDD
FT                   GTSFISKAITLVLIPPAYLFVILLHIAARVVISPAIHPTISSTSSEPHSQPQQTRKDPA
FT                   AEDDFSFPLEPQTSSEYEDAQLFKKLDPWDLD"
     MPESPSELGQ IQSLRRSLTL PTKLNPLAQR RSSVPNTPEH VIFYHPSAKI VHFSPRALAP        60
     IPSSSAPSDF DYPVDTIETL PWRSATERTV ATAPLRLEKV HGSTAFLKCG NVVHAILKNS       120
     QCWCVDGVSK FVLRIRPLTY YRIEIPYETE DERSLVRDLK IALPTVLRYE VTPCPFKRAF       180
     SVELPSDAMA PRRKKAWQPK DRRERVPTVL EPRRETPSPS SIRSDCIDSA STGDDTDGNL       240
     TDDSCFTSNK ANSTVLETIP DDRESSPVEA LSPSPYLGPP RRSVSETPQT FTSLLAKFEA       300
     TSVAENDQDS ELVLKPEYAS RADVVPEIDH ELKVAEQLEP EFLADGVEAG PGSETVLDAE       360
     SKTAAQPGDK PEHDPEAILH AGRSSEAAVK EEPIISAETD AALAAETSEE AVFRAEPTTA       420
     VEAEAVPEGN VMNVEGVQII QPAAEPTLDI DHDASFASNP ESFHSAEPHS PDSVSTHPTS       480
     VGGHELPESE EKFNISSTNH IISGYESAPA DPCKTSQPPT LNIPQSDHAS NQTSLPGPPL       540
     VHGTSSNNLP RRFADAFSDT SPSMAPTSNE NPPSRSTDAS SDTHMRPSVH AKAAPLNTDF       600
     DHMSAEFRRR SKATRERDVS PMPHSSALYQ PSGDDGTSFI SKAITLVLIP PAYLFVILLH       660
     IAARVVISPA IHPTISSTSS EPHSQPQQTR KDPAAEDDFS FPLEPQTSSE YEDAQLFKKL       720
     DPWDLD                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page