(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE485

PENCW_16.PE485       Location/Qualifiers
FT   CDS             join(complement(1094814..1094840),
FT                   complement(1094364..1094723))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978103"
FT                   /orf_name="Pc20g04850"
FT                   /product="Pc20g04850 protein"
FT                   /function="7S RNA binding"
FT                   /function="endoplasmic reticulum signal peptide binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /biological_process="negative regulation of translational
FT                   elongation"
FT                   /cellular_component="signal recognition particle,
FT                   endoplasmic reticulum targeting"
FT                   /protein_id="CAP85814.1"
FT                   /db_xref="GO:0005786"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0030942"
FT                   /db_xref="GO:0045900"
FT                   /db_xref="InterPro:IPR003210"
FT                   /db_xref="InterPro:IPR009018"
FT                   /db_xref="UniParc:UPI0001831848"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE93"
FT                   /transl_table=1
FT                   /translation="MAPHLGQDEFFKSLGELLSKTSQQHQGSVYLTQKPLIDVPGATTT
FT                   NSQPSILIRATDGNTNTPNLKKEGKDKKSQKVKLSTIVNPDEIEAFYVRYAEVCKAGMT
FT                   GLKKRDRRGRKAKTKGGAAKVTKA"
     MAPHLGQDEF FKSLGELLSK TSQQHQGSVY LTQKPLIDVP GATTTNSQPS ILIRATDGNT        60
     NTPNLKKEGK DKKSQKVKLS TIVNPDEIEA FYVRYAEVCK AGMTGLKKRD RRGRKAKTKG       120
     GAAKVTKA                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page