(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE486

PENCW_16.PE486       Location/Qualifiers
FT   CDS             join(1095157..1095225,1095291..1096605,1096662..1097848)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949970"
FT                   /orf_name="Pc20g04860"
FT                   /product="Pc20g04860 protein"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="CAP85815.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001831849"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE94"
FT                   /transl_table=1
FT                   /translation="MSTVTRSVASTDLPRAKNAAKMSRSQQKPQKRARGDSDEDSADED
FT                   LDLNSDDMDLDEGLSEPQTKSKSAKEAAKKPKSILKKAAVPQDSESDSEPESGFGSEID
FT                   LDEDEDEDEDEDEDEDEVDESDDESEDDTYEGEPKETEAHIPGSVKAKLAQDDAEIAEL
FT                   EKRLGLKKGGKLPKAFEEDGLDELLGDLAGGADASEDESKKRKREADDWLRNKRLKAKS
FT                   LQAQQVEKDESEMDSAEDFDLDEEIFGGDDSDEAAEGSDFDGFDEEEPKEPKKKENPYI
FT                   APVTKPEATAQKYIPPSLRARSDPESESLTRLKRQAQGHLNKLSEANMLSIVAEFEKLY
FT                   RDYPRQHVTSTLVSLLMGLICERAALQDTFLILHAGFIAALYKLMGMDIGAEIIQTVVE
FT                   TLDAGGDERGSFQGKEATNLVSLLSQLYNFHVVGSSLMFDYVRLYVQDITESNTELLLK
FT                   VIRNSGPQLRLDDPSALKDIVLLIQPAVAKAGEDRLSVRTKFMIDLITDLKNNRSKASA
FT                   AAGAGITTEHITKMRKILGSLNSSRVIRASEPINISRDDIHNSSKKGKWWLVGASWKED
FT                   PLVTAQREMAGVQVTQPEARDDESDGEPDFGVLARAHRMNTDVRRSIFVAIMSANDFQD
FT                   AHVRLMKLRLKRAQEFEIPRVLLHCAMEEEAHNPYYSLIARRICGEQGRRIKMSFMFAL
FT                   WNVFKKMGERGDIDDDEETNFDPDDEENGVSMKSVVNLAKMFSTLIVDGTLTLSILKNL
FT                   NFAYLQPKTKTFVEVLVISIIQQSQKSKKKKKSKSSMPDESEKNEGPLMQIFLRVKETP
FT                   HIAKGLIYFVRKVVAKSDIVSSEELKLVRWGCNVAADALKAVAE"
     MSTVTRSVAS TDLPRAKNAA KMSRSQQKPQ KRARGDSDED SADEDLDLNS DDMDLDEGLS        60
     EPQTKSKSAK EAAKKPKSIL KKAAVPQDSE SDSEPESGFG SEIDLDEDED EDEDEDEDED       120
     EVDESDDESE DDTYEGEPKE TEAHIPGSVK AKLAQDDAEI AELEKRLGLK KGGKLPKAFE       180
     EDGLDELLGD LAGGADASED ESKKRKREAD DWLRNKRLKA KSLQAQQVEK DESEMDSAED       240
     FDLDEEIFGG DDSDEAAEGS DFDGFDEEEP KEPKKKENPY IAPVTKPEAT AQKYIPPSLR       300
     ARSDPESESL TRLKRQAQGH LNKLSEANML SIVAEFEKLY RDYPRQHVTS TLVSLLMGLI       360
     CERAALQDTF LILHAGFIAA LYKLMGMDIG AEIIQTVVET LDAGGDERGS FQGKEATNLV       420
     SLLSQLYNFH VVGSSLMFDY VRLYVQDITE SNTELLLKVI RNSGPQLRLD DPSALKDIVL       480
     LIQPAVAKAG EDRLSVRTKF MIDLITDLKN NRSKASAAAG AGITTEHITK MRKILGSLNS       540
     SRVIRASEPI NISRDDIHNS SKKGKWWLVG ASWKEDPLVT AQREMAGVQV TQPEARDDES       600
     DGEPDFGVLA RAHRMNTDVR RSIFVAIMSA NDFQDAHVRL MKLRLKRAQE FEIPRVLLHC       660
     AMEEEAHNPY YSLIARRICG EQGRRIKMSF MFALWNVFKK MGERGDIDDD EETNFDPDDE       720
     ENGVSMKSVV NLAKMFSTLI VDGTLTLSIL KNLNFAYLQP KTKTFVEVLV ISIIQQSQKS       780
     KKKKKSKSSM PDESEKNEGP LMQIFLRVKE TPHIAKGLIY FVRKVVAKSD IVSSEELKLV       840
     RWGCNVAADA LKAVAE                                                       856
//

If you have problems or comments...

PBIL Back to PBIL home page