(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE49

PENCW_16.PE49        Location/Qualifiers
FT   CDS             join(109708..109840,109891..109961,110016..110177,
FT                   110244..110665,110717..110807,110858..111226,1
FT                   11280..111444)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824089"
FT                   /orf_name="Pc20g00490"
FT                   /product="Pc20g00490 protein"
FT                   /function="ATP binding"
FT                   /function="serine-tRNA ligase activity"
FT                   /biological_process="seryl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85378.1"
FT                   /db_xref="GO:0004828"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006434"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniParc:UPI0001831AB4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN8"
FT                   /transl_table=1
FT                   /translation="MLDLADFVTERGGDIKKIKESQQKRFAPEEAVDEVVALYEEARRA
FT                   RYDVTQMGSQINGVQKAIGMKKKNKEDATELLAQKAELETKKKELEEAAVAKEVQRDRK
FT                   IRTIGNYVHESVPVSNDEADNKLIKTWTPEGAEMQKPGCLSHHEVLTRLDGYDPERGVK
FT                   IVGHRGYCLTGYGLFLNLALINYGLEFLFNKGYTPNQPPQFMLKDLMAKTAQLEQFDEE
FT                   LYKVTESEDKSTDKYLIATSEQPLSALHDSEWLQDKDLPIKYAGYSTCYRKEAGSHGKD
FT                   AWGIFRVHQFEKIEQFVLTKPEDSWQAFEDMMNTSEEFYQSLKLPYNIVAIVSGALNNA
FT                   ASKKYDLEAWFPFQQEYKELVSCSNCTDYQARALEIRYGAKKATDLKKTYVHALNSTLC
FT                   ATERTLCCVLENYQKEDGIEVPEVLRKYIPGAPEFLPYTKELPKDTTSSKAKAKANKGT
FT                   DDAAKKMQGLQV"
     MLDLADFVTE RGGDIKKIKE SQQKRFAPEE AVDEVVALYE EARRARYDVT QMGSQINGVQ        60
     KAIGMKKKNK EDATELLAQK AELETKKKEL EEAAVAKEVQ RDRKIRTIGN YVHESVPVSN       120
     DEADNKLIKT WTPEGAEMQK PGCLSHHEVL TRLDGYDPER GVKIVGHRGY CLTGYGLFLN       180
     LALINYGLEF LFNKGYTPNQ PPQFMLKDLM AKTAQLEQFD EELYKVTESE DKSTDKYLIA       240
     TSEQPLSALH DSEWLQDKDL PIKYAGYSTC YRKEAGSHGK DAWGIFRVHQ FEKIEQFVLT       300
     KPEDSWQAFE DMMNTSEEFY QSLKLPYNIV AIVSGALNNA ASKKYDLEAW FPFQQEYKEL       360
     VSCSNCTDYQ ARALEIRYGA KKATDLKKTY VHALNSTLCA TERTLCCVLE NYQKEDGIEV       420
     PEVLRKYIPG APEFLPYTKE LPKDTTSSKA KAKANKGTDD AAKKMQGLQV                  470
//

If you have problems or comments...

PBIL Back to PBIL home page