(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE492

PENCW_16.PE492       Location/Qualifiers
FT   CDS             join(1118907..1119013,1119102..1119210)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949973"
FT                   /orf_name="Pc20g04920"
FT                   /product="Pc20g04920 protein"
FT                   /protein_id="CAP85821.1"
FT                   /db_xref="UniParc:UPI0001831924"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB7"
FT                   /transl_table=1
FT                   /translation="MPRPNCPWRQIAPKGDGSPDDLGNVPVTLDELEIDACSSHEGHGS
FT                   RMGLCYHAAEIYISFCRITLVADFVD"
     MPRPNCPWRQ IAPKGDGSPD DLGNVPVTLD ELEIDACSSH EGHGSRMGLC YHAAEIYISF        60
     CRITLVADFV D                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page