(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE493

PENCW_16.PE493       Location/Qualifiers
FT   CDS             <1120007..>1120274
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949974"
FT                   /orf_name="Pc20g04930"
FT                   /product="Pc20g04930 protein"
FT                   /protein_id="CAP85822.1"
FT                   /db_xref="UniParc:UPI0001831925"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB8"
FT                   /transl_table=1
FT                   /translation="MVYVVKGSALVLSDGTDTETTITLRPYTEGTRGSSMIFGMSPCPL
FT                   MDIKTRMDRALYWAVAGLSQPETTGSSVNYLLPTVKTSRPPRNV"
     MVYVVKGSAL VLSDGTDTET TITLRPYTEG TRGSSMIFGM SPCPLMDIKT RMDRALYWAV        60
     AGLSQPETTG SSVNYLLPTV KTSRPPRNV                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page