(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE494

PENCW_16.PE494       Location/Qualifiers
FT   CDS             join(1122310..1122338,1122773..1122801,1122847..1123087,
FT                   1123161..1123173,1123229..1123378,1123504..1123746,
FT                   1123825..1123971)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978105"
FT                   /orf_name="Pc20g04940"
FT                   /product="Putative uncharacterized protein Pc20g04940 "
FT                   /protein_id="CAP85823.1"
FT                   /db_xref="UniParc:UPI0001831926"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB9"
FT                   /transl_table=1
FT                   /translation="MWTTAEYLLVTSDSESKTIKMTDTREVILLDNLDIAQLRILRVKM
FT                   IGRNNTRAEITRANAAIRSSHAQLMRDFDGQPELLMPATIAMNHSLALLAYMSRIKGFV
FT                   FLPTPRYDTPEVRSLVYLTHLITSYWTLPSRIVTIRGQGRILTPIGDCPLVPEGIEGNR
FT                   VELLACLSWAEQFWLNVEGDFGPGEDGESGFLLPRDLIDGIAACVRHLVSSFDNFTKAH
FT                   RRAHSLAGTNLSHVSSRSSLVVPGNLAVNFDSEWAELSVESSHCPHSRAAEEPARSWYI
FT                   LS"
     MWTTAEYLLV TSDSESKTIK MTDTREVILL DNLDIAQLRI LRVKMIGRNN TRAEITRANA        60
     AIRSSHAQLM RDFDGQPELL MPATIAMNHS LALLAYMSRI KGFVFLPTPR YDTPEVRSLV       120
     YLTHLITSYW TLPSRIVTIR GQGRILTPIG DCPLVPEGIE GNRVELLACL SWAEQFWLNV       180
     EGDFGPGEDG ESGFLLPRDL IDGIAACVRH LVSSFDNFTK AHRRAHSLAG TNLSHVSSRS       240
     SLVVPGNLAV NFDSEWAELS VESSHCPHSR AAEEPARSWY ILS                         283
//

If you have problems or comments...

PBIL Back to PBIL home page