(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE496

PENCW_16.PE496       Location/Qualifiers
FT   CDS             join(1128059..1128830,1128924..1129735)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129273"
FT                   /orf_name="Pc20g04960"
FT                   /product="Pc20g04960 protein"
FT                   /protein_id="CAP85825.1"
FT                   /db_xref="UniParc:UPI0001831927"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC0"
FT                   /transl_table=1
FT                   /translation="MRPPSLLPLLGFIGLSCALSTTVDNEPVKNANHIFNVIQDSMRQW
FT                   GSSLHHNGVSFFLAGVPTGTQFYHGTSKASPVNGTEWLAFEPEHAMVFARPRRGPPPHL
FT                   PPDDPNTERHARGHGELRKRDHYNKDEKHHGPPGGRAPKESDENEAGYLHTYAAAKDLR
FT                   LLYLDGMSAAKTSKGTLDSQDAVLFAGSLDDHPSPGGQENERARLACEMAQSEWEGRID
FT                   GVLRMEAGFEIILCDFERDLIPVRITQVKRSSEEHRDDGNIHGPGGPGGPGAPPHGGPG
FT                   NGPDASRWMRAITARYNGIGGNRVSLNFNHFVTAFSHDVELFRDNSTFPRFVGLSAEER
FT                   AAIRAEVTDLVMTYHPAEVGEDWQAITDMIVIRYSKELSYFVSDSIDSIERLQSEIERV
FT                   LSPFIDYSERDDVAEIERCATQFLPSTSFESGGIAARAVYGVTHRICSSLVEAGKGRDL
FT                   MSAIRVIRDLVGYLDWATWKECRGCAANEICVVPIWPMGTVQDYDSPQCKDASNPYDQG
FT                   GESYWGGMRN"
     MRPPSLLPLL GFIGLSCALS TTVDNEPVKN ANHIFNVIQD SMRQWGSSLH HNGVSFFLAG        60
     VPTGTQFYHG TSKASPVNGT EWLAFEPEHA MVFARPRRGP PPHLPPDDPN TERHARGHGE       120
     LRKRDHYNKD EKHHGPPGGR APKESDENEA GYLHTYAAAK DLRLLYLDGM SAAKTSKGTL       180
     DSQDAVLFAG SLDDHPSPGG QENERARLAC EMAQSEWEGR IDGVLRMEAG FEIILCDFER       240
     DLIPVRITQV KRSSEEHRDD GNIHGPGGPG GPGAPPHGGP GNGPDASRWM RAITARYNGI       300
     GGNRVSLNFN HFVTAFSHDV ELFRDNSTFP RFVGLSAEER AAIRAEVTDL VMTYHPAEVG       360
     EDWQAITDMI VIRYSKELSY FVSDSIDSIE RLQSEIERVL SPFIDYSERD DVAEIERCAT       420
     QFLPSTSFES GGIAARAVYG VTHRICSSLV EAGKGRDLMS AIRVIRDLVG YLDWATWKEC       480
     RGCAANEICV VPIWPMGTVQ DYDSPQCKDA SNPYDQGGES YWGGMRN                     527
//

If you have problems or comments...

PBIL Back to PBIL home page