(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE497

PENCW_16.PE497       Location/Qualifiers
FT   CDS             complement(1130025..1131053)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949975"
FT                   /orf_name="Pc20g04970"
FT                   /product="Pc20g04970 protein"
FT                   /protein_id="CAP85826.1"
FT                   /db_xref="UniParc:UPI0001831928"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC1"
FT                   /transl_table=1
FT                   /translation="MKSFAFSAAVLASTAMALPANLANLVNNIPSGTTDALPSGVPSCL
FT                   PSGVIPSGIPLPVVSMIPTCPGAAASSAMSGLPIPTGAASDLTQGAAPNQLLSTLNGAG
FT                   HGQVLSILNQAGTSSIKMTAESELQSLMSKLPVSALQKPVGQVIQTADSVDQLNTSGGS
FT                   GLHQVTAVLDNGNAALIQLTSEVVNLLDGLGLGQVGGLIGSIVGGLESVTGYIKRDTLQ
FT                   NVLSITDVNGIAGGKNLLAQLEPSLLGGLLGGGLDLSTVQGPVGNVVAMAPSVSELKSK
FT                   IPNIPGADFIAVTTEDKASVLLVKVESTVQTLLSSLGLGSVGTTVGSIVSSASSAKGAL
FT                   PL"
     MKSFAFSAAV LASTAMALPA NLANLVNNIP SGTTDALPSG VPSCLPSGVI PSGIPLPVVS        60
     MIPTCPGAAA SSAMSGLPIP TGAASDLTQG AAPNQLLSTL NGAGHGQVLS ILNQAGTSSI       120
     KMTAESELQS LMSKLPVSAL QKPVGQVIQT ADSVDQLNTS GGSGLHQVTA VLDNGNAALI       180
     QLTSEVVNLL DGLGLGQVGG LIGSIVGGLE SVTGYIKRDT LQNVLSITDV NGIAGGKNLL       240
     AQLEPSLLGG LLGGGLDLST VQGPVGNVVA MAPSVSELKS KIPNIPGADF IAVTTEDKAS       300
     VLLVKVESTV QTLLSSLGLG SVGTTVGSIV SSASSAKGAL PL                          342
//

If you have problems or comments...

PBIL Back to PBIL home page