(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE498

PENCW_16.PE498       Location/Qualifiers
FT   CDS             join(1131835..1132020,1132107..1132247)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978106"
FT                   /orf_name="Pc20g04980"
FT                   /product="Putative uncharacterized protein Pc20g04980 "
FT                   /protein_id="CAP85827.1"
FT                   /db_xref="UniParc:UPI0001831929"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC2"
FT                   /transl_table=1
FT                   /translation="MVNDSWPSVLRSLEISSLCAKRNCTKEVKLHVDNINADCNFIPPQ
FT                   WVKMSNSSVDPGRPLIAGVGLTGATKTPPASMYVVDISILLLPTLLYSVLSQFQSKLKA
FT                   NQQI"
     MVNDSWPSVL RSLEISSLCA KRNCTKEVKL HVDNINADCN FIPPQWVKMS NSSVDPGRPL        60
     IAGVGLTGAT KTPPASMYVV DISILLLPTL LYSVLSQFQS KLKANQQI                    108
//

If you have problems or comments...

PBIL Back to PBIL home page