(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE499

PENCW_16.PE499       Location/Qualifiers
FT   CDS             join(complement(1132900..1134429),
FT                   complement(1132740..1132844))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234554" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949976"
FT                   /orf_name="Pc20g04990"
FT                   /product="Pc20g04990 protein"
FT                   /EC_number="1.1.99.18"
FT                   /function="cellobiose dehydrogenase (acceptor) activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="alcohol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85828.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0047735"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI000183192A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC3"
FT                   /transl_table=1
FT                   /translation="MRIFQAGPLAIALSVFTGAASASAFQNHTYDYIVVGGGPSGIISA
FT                   EKFAQAGKKVLLLERGVGPTVATGNNETLTWDHSLTPIDLPGLSANIGALDVWNQYMCT
FT                   DTAGNAACVLGGGVTVNYMVFVHPPARDFDDKWPEGWKWKDVESAADRLYKRNPGTTLP
FT                   SADGKRYDQGLYNVLSKFLSGLGWKSVDMIAEPNEKHQIYSYPSWNVQDQMRAGPVRTY
FT                   LPAAAKLDNFHLALRTKVIRLVRSGSQVTGVEVQTPSGRSQIITVAPHGRVVLAAGALS
FT                   TPRLLWNSGIGGKAQIETAKKSGVAVPPKAQWIDLPVGVGLKDHPIFPITFNTNASFGL
FT                   VDYEGVLNGTDSRDISLYRKHSGVLTQGKHRLIFFTSEEIDGHTQYYQGSCAPTDEGVV
FT                   TMTTYMTHGLTSSGVLGLDASGNTVIEKLPYLQTAADRKAARTFIQKMVKDITAPSTGF
FT                   ELETHTNVSAILKAQTPGTHYVSSAKMGTDDGRKNGTSVVDTNAKVYGVDNLFIVDASI
FT                   HPDLPTGNIQTAVMVVAEAAAVKILSN"
     MRIFQAGPLA IALSVFTGAA SASAFQNHTY DYIVVGGGPS GIISAEKFAQ AGKKVLLLER        60
     GVGPTVATGN NETLTWDHSL TPIDLPGLSA NIGALDVWNQ YMCTDTAGNA ACVLGGGVTV       120
     NYMVFVHPPA RDFDDKWPEG WKWKDVESAA DRLYKRNPGT TLPSADGKRY DQGLYNVLSK       180
     FLSGLGWKSV DMIAEPNEKH QIYSYPSWNV QDQMRAGPVR TYLPAAAKLD NFHLALRTKV       240
     IRLVRSGSQV TGVEVQTPSG RSQIITVAPH GRVVLAAGAL STPRLLWNSG IGGKAQIETA       300
     KKSGVAVPPK AQWIDLPVGV GLKDHPIFPI TFNTNASFGL VDYEGVLNGT DSRDISLYRK       360
     HSGVLTQGKH RLIFFTSEEI DGHTQYYQGS CAPTDEGVVT MTTYMTHGLT SSGVLGLDAS       420
     GNTVIEKLPY LQTAADRKAA RTFIQKMVKD ITAPSTGFEL ETHTNVSAIL KAQTPGTHYV       480
     SSAKMGTDDG RKNGTSVVDT NAKVYGVDNL FIVDASIHPD LPTGNIQTAV MVVAEAAAVK       540
     ILSN                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page