(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE500

PENCW_16.PE500       Location/Qualifiers
FT   CDS             1136437..1137414
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000184929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949977"
FT                   /orf_name="Pc20g05000"
FT                   /product="Pc20g05000 protein"
FT                   /protein_id="CAP85829.1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000183192B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC4"
FT                   /transl_table=1
FT                   /translation="MSSPAARLIPASSRTLLLTFDAFGTLFHPRLPVPEQYAATAHQFG
FT                   LSRTAVTPDKLATAFKDTFRAQMRQYPNYGRADVLRGQYGGPRQWWEEVIRGSFGRVLS
FT                   TENGETRPETPKEHIPDGMVEALLDRFAGAEGYALYDDVLPFFRRMRKLKSANKWSFDR
FT                   IIVGVVSNSDDRVPVVLKSLGLTVGDMRADQDQSSMDLPGFEVRGMKKDVAGEHGKDHA
FT                   DGNLDLDIDMVITSYEAGEEKPHRLIFDVARRQALKVARPWLTSRTKFKSVHVGDDFKK
FT                   DYQGASDAGWESYLLPRDSHGAEGSEAKQFPDLLGLADKLDLFP"
     MSSPAARLIP ASSRTLLLTF DAFGTLFHPR LPVPEQYAAT AHQFGLSRTA VTPDKLATAF        60
     KDTFRAQMRQ YPNYGRADVL RGQYGGPRQW WEEVIRGSFG RVLSTENGET RPETPKEHIP       120
     DGMVEALLDR FAGAEGYALY DDVLPFFRRM RKLKSANKWS FDRIIVGVVS NSDDRVPVVL       180
     KSLGLTVGDM RADQDQSSMD LPGFEVRGMK KDVAGEHGKD HADGNLDLDI DMVITSYEAG       240
     EEKPHRLIFD VARRQALKVA RPWLTSRTKF KSVHVGDDFK KDYQGASDAG WESYLLPRDS       300
     HGAEGSEAKQ FPDLLGLADK LDLFP                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page