(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE501

PENCW_16.PE501       Location/Qualifiers
FT   CDS             join(1138558..1138635,1138691..1138876,1138984..1139095,
FT                   1139223..1139349,1139401..1139692)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141498" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824911"
FT                   /orf_name="Pc20g05010"
FT                   /product="Pc20g05010 protein"
FT                   /function="coenzyme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid metabolic process "
FT                   /protein_id="CAP85830.1"
FT                   /db_xref="GO:0006631"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniParc:UPI000183192C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC5"
FT                   /transl_table=1
FT                   /translation="MEGVQKPQGSVVIIGAGTQGRRLAHMWSSRGGTVRLVDLQEQQLE
FT                   DGLKYVEQLRADATDHEGDWGRIETSQPASLQSTLKDSWLVVELAPESTIIASNSSSYG
FT                   IFEILEGMSLKNNKRVMSAHCSIEIMGHKDSDPKLIALVLEQCKEHGFSPFYVRENSIG
FT                   YIYNRIWAAIKRETLLTLSEGVATPKEIDAIFKDVLKTPKGPCEQMDVVGLDVVLDIEN
FT                   HYAESRSGIPTEPRDYLRRMIQGGSLGVKNGRGFYDYEDQNK"
     MEGVQKPQGS VVIIGAGTQG RRLAHMWSSR GGTVRLVDLQ EQQLEDGLKY VEQLRADATD        60
     HEGDWGRIET SQPASLQSTL KDSWLVVELA PESTIIASNS SSYGIFEILE GMSLKNNKRV       120
     MSAHCSIEIM GHKDSDPKLI ALVLEQCKEH GFSPFYVREN SIGYIYNRIW AAIKRETLLT       180
     LSEGVATPKE IDAIFKDVLK TPKGPCEQMD VVGLDVVLDI ENHYAESRSG IPTEPRDYLR       240
     RMIQGGSLGV KNGRGFYDYE DQNK                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page