(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE502

PENCW_16.PE502       Location/Qualifiers
FT   CDS             join(complement(1141313..1144182),
FT                   complement(1140193..1141264))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978107"
FT                   /orf_name="Pc20g05020"
FT                   /product="Pc20g05020 protein"
FT                   /protein_id="CAP85831.1"
FT                   /db_xref="InterPro:IPR018564"
FT                   /db_xref="UniParc:UPI00018319F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC6"
FT                   /transl_table=1
FT                   /translation="MSSPSTPRSTRSASPAGDSPNIITPGQKIKSMMAQFDSDSEDDAQ
FT                   IAKSTAAVSKLDLGRGGVPAADARENRPLHDSEDNSDSADEVFRPKGRMAARLQGNSRP
FT                   VEPEDEKSAFSRVSKAFRSEKEQGEKPQRTESQPTPIGESSDDDDLPTAGPRRKHKSTT
FT                   NSPNSNNRTSQTPPRSRADSPLFVSSPGEPHDDPNAEDTEHAAETKPKGNARFLSLVAQ
FT                   KRKEREEREKAEAERKKAIRRVQMEQLSSQVNSGEESGADDPSTASKLSQKARQPRKAS
FT                   KKALDEMRQETQRMSRNMQLAHQAKTKKKITKESLFAKFNFMQPDPPVEQLAANSSSAV
FT                   GSQNSSDGERAKTKDTPHTSPVLGHLDPSKASADFENAQVQAADVDMDADTEDLPAPKD
FT                   LLAPNQHPALSKDTAVQDVSLSIPEPKSEDGKSKRVSRPLTQPPIRVLLSRQDVAAHQK
FT                   DSDDSDSDLEVVTSPGKCRRIAAFENLPTRQSHEDPSMTKLKALAHLTSPTRKMASMNS
FT                   AELSANLLWRARQQAAKERRERIEELRAKGVVIETAEERAAMEDDMENLVDKARKEADE
FT                   IRRLEKAAGKKANGDDDEEEDDDYELSGSDQERDAEVDDEEDEEEEHERVNGGGDFVEH
FT                   EADEDDDSADDESEAEAAPSDAENEVPAPRRRRRTRVVSDNEDEDQPQPPSTPVRASSH
FT                   APQSAERPNFLGMGTSGDTSLGLTQAFASTLDGNGAGTQAESATMPFSLPDPGQPVPQL
FT                   RKEESEVLVPDSQPQPQDKDFMEGYAQSVTRVSESPAPYAFSEFSQSQLPDPTQDEGFV
FT                   FSPFDPAKRFRGTPPMSTVDTVLVGQTQSPIADRKRKMLRRGRATELPQVDENDDEGGF
FT                   EISANAFDVMKKDKALKKKPAPQYNKNNSKAKEIVDEAAEESEDEYAGLGGNSDESDGE
FT                   ENAIDRQMINDNSGEVVDEKQLAALNAVHDRNRDEKDVAKLMRDITTGALRRRKNADDD
FT                   FDLDDSDDEHLARRREKQREFAKMRRALLADEKIGEIAENPKKAAFFKAVEDREVDDDF
FT                   NIDFLEEEDHGSQGEASQDAASGEQSNDTASDGQNRKRPLEPSAEDATNRPPPRLRRTT
FT                   ASAMSKKPATIAEIRETLSFLTETPEYDSFQEDASLDEVEHDQEDEGTPGAEVQGHEDQ
FT                   PHSDNTFAKPSHPRRTRGVVVDRLALLRQASSNSATGTNSGSANSKLAFHSGSGGEGPI
FT                   GFRPPQLLRRVTTGSSSSSSSSASNRVSKAAASGPKKGGAVNSYTAAREREREKELRIK
FT                   QRSGGSNIAKLLGKHTGGGLGALDKGQWD"
     MSSPSTPRST RSASPAGDSP NIITPGQKIK SMMAQFDSDS EDDAQIAKST AAVSKLDLGR        60
     GGVPAADARE NRPLHDSEDN SDSADEVFRP KGRMAARLQG NSRPVEPEDE KSAFSRVSKA       120
     FRSEKEQGEK PQRTESQPTP IGESSDDDDL PTAGPRRKHK STTNSPNSNN RTSQTPPRSR       180
     ADSPLFVSSP GEPHDDPNAE DTEHAAETKP KGNARFLSLV AQKRKEREER EKAEAERKKA       240
     IRRVQMEQLS SQVNSGEESG ADDPSTASKL SQKARQPRKA SKKALDEMRQ ETQRMSRNMQ       300
     LAHQAKTKKK ITKESLFAKF NFMQPDPPVE QLAANSSSAV GSQNSSDGER AKTKDTPHTS       360
     PVLGHLDPSK ASADFENAQV QAADVDMDAD TEDLPAPKDL LAPNQHPALS KDTAVQDVSL       420
     SIPEPKSEDG KSKRVSRPLT QPPIRVLLSR QDVAAHQKDS DDSDSDLEVV TSPGKCRRIA       480
     AFENLPTRQS HEDPSMTKLK ALAHLTSPTR KMASMNSAEL SANLLWRARQ QAAKERRERI       540
     EELRAKGVVI ETAEERAAME DDMENLVDKA RKEADEIRRL EKAAGKKANG DDDEEEDDDY       600
     ELSGSDQERD AEVDDEEDEE EEHERVNGGG DFVEHEADED DDSADDESEA EAAPSDAENE       660
     VPAPRRRRRT RVVSDNEDED QPQPPSTPVR ASSHAPQSAE RPNFLGMGTS GDTSLGLTQA       720
     FASTLDGNGA GTQAESATMP FSLPDPGQPV PQLRKEESEV LVPDSQPQPQ DKDFMEGYAQ       780
     SVTRVSESPA PYAFSEFSQS QLPDPTQDEG FVFSPFDPAK RFRGTPPMST VDTVLVGQTQ       840
     SPIADRKRKM LRRGRATELP QVDENDDEGG FEISANAFDV MKKDKALKKK PAPQYNKNNS       900
     KAKEIVDEAA EESEDEYAGL GGNSDESDGE ENAIDRQMIN DNSGEVVDEK QLAALNAVHD       960
     RNRDEKDVAK LMRDITTGAL RRRKNADDDF DLDDSDDEHL ARRREKQREF AKMRRALLAD      1020
     EKIGEIAENP KKAAFFKAVE DREVDDDFNI DFLEEEDHGS QGEASQDAAS GEQSNDTASD      1080
     GQNRKRPLEP SAEDATNRPP PRLRRTTASA MSKKPATIAE IRETLSFLTE TPEYDSFQED      1140
     ASLDEVEHDQ EDEGTPGAEV QGHEDQPHSD NTFAKPSHPR RTRGVVVDRL ALLRQASSNS      1200
     ATGTNSGSAN SKLAFHSGSG GEGPIGFRPP QLLRRVTTGS SSSSSSSASN RVSKAAASGP      1260
     KKGGAVNSYT AAREREREKE LRIKQRSGGS NIAKLLGKHT GGGLGALDKG QWD             1313
//

If you have problems or comments...

PBIL Back to PBIL home page