(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE503

PENCW_16.PE503       Location/Qualifiers
FT   CDS             join(complement(1146764..1146972),
FT                   complement(1145955..1146703),complement(1145765..1145904),
FT                   complement(1144985..1145716))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672212"
FT                   /orf_name="Pc20g05030"
FT                   /product="Pc20g05030 protein"
FT                   /function="DNA binding"
FT                   /biological_process="histone modification"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85832.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016570"
FT                   /db_xref="InterPro:IPR004343"
FT                   /db_xref="UniParc:UPI00018319F7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC7"
FT                   /transl_table=1
FT                   /translation="MADDLDAELLALAGDSEEETSPPPKSPAHSSSSHVQERDTSPAPM
FT                   GRKGTAKPVSRRSRKPVKDESEGEISDDGSRHSLQSAPMSESESEADNSDDNDEDRPIF
FT                   PYEKLYYSAQDKKDIMAMPEIQREETLSERAQQVDRHNQDLALRRLLASRSREEARAAK
FT                   KAKRKAGSAGLDDNQRKSSRQKTTLGGRKVGETSGAIEAYKRQREQKGKRDELRRRDPT
FT                   KSRRRSRSVGSDISEEDADAESDLELDDRVGRAPSIPKDDPPAELREIRRAQIGRNNFA
FT                   KVCFYPGFENAMIGCYARLSIGPHPETGQNEYRLGLITGISQGKPYALEGENGRSFVTD
FT                   QYVKLAHGKAVRDFPFVTFSNSPLTEAEYRRYVQTLAVEDCKMATKSKVESKVADINRL
FT                   LNHTFTREELNEKLRRQGAFDEKKNVLNRLELERNLEFAKVNGNVEEAEKIEAELQKLA
FT                   TPALSWGTSLVKKEADKGLSEAERVHQINLRNQKLNIENGRRAQLEERKAAKKAAQAVA
FT                   RGEAAPNPFMRVRTVAKTHHDVNGVHKAAAAEAASVDSQKDTPAKSDGSPAQKATPGSR
FT                   VTPKKPKNGFMISYRNTDDENIAALDMDIDIEI"
     MADDLDAELL ALAGDSEEET SPPPKSPAHS SSSHVQERDT SPAPMGRKGT AKPVSRRSRK        60
     PVKDESEGEI SDDGSRHSLQ SAPMSESESE ADNSDDNDED RPIFPYEKLY YSAQDKKDIM       120
     AMPEIQREET LSERAQQVDR HNQDLALRRL LASRSREEAR AAKKAKRKAG SAGLDDNQRK       180
     SSRQKTTLGG RKVGETSGAI EAYKRQREQK GKRDELRRRD PTKSRRRSRS VGSDISEEDA       240
     DAESDLELDD RVGRAPSIPK DDPPAELREI RRAQIGRNNF AKVCFYPGFE NAMIGCYARL       300
     SIGPHPETGQ NEYRLGLITG ISQGKPYALE GENGRSFVTD QYVKLAHGKA VRDFPFVTFS       360
     NSPLTEAEYR RYVQTLAVED CKMATKSKVE SKVADINRLL NHTFTREELN EKLRRQGAFD       420
     EKKNVLNRLE LERNLEFAKV NGNVEEAEKI EAELQKLATP ALSWGTSLVK KEADKGLSEA       480
     ERVHQINLRN QKLNIENGRR AQLEERKAAK KAAQAVARGE AAPNPFMRVR TVAKTHHDVN       540
     GVHKAAAAEA ASVDSQKDTP AKSDGSPAQK ATPGSRVTPK KPKNGFMISY RNTDDENIAA       600
     LDMDIDIEI                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page