(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE504

PENCW_16.PE504       Location/Qualifiers
FT   CDS             1147418..1148161
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824912"
FT                   /orf_name="Pc20g05040"
FT                   /product="Pc20g05040 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="transition metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein metabolic process "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="CAP85833.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniParc:UPI00018319F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC8"
FT                   /transl_table=1
FT                   /translation="MLSSPILRRCALTHCRHSAPAATPIFLDFLAPSTFKHGQCRQAST
FT                   TAGTPGGSKPLYVLSKEQREFMDSALRVNQAGEIAATLIYKAQTPQIVRSYPHLRPLMK
FT                   HMYDQEAGHLKTFNHLIAKHQIRPTAMSPAWEVAATFLGWSTAALGREAAMACTEAVET
FT                   EIGSHYNDQVREILSWEADAERRGEELDEELKEMLATFRRIRDEELEHLDHAVANDSKE
FT                   AKPYDPLVDVIRFGCRAAIKISEKV"
     MLSSPILRRC ALTHCRHSAP AATPIFLDFL APSTFKHGQC RQASTTAGTP GGSKPLYVLS        60
     KEQREFMDSA LRVNQAGEIA ATLIYKAQTP QIVRSYPHLR PLMKHMYDQE AGHLKTFNHL       120
     IAKHQIRPTA MSPAWEVAAT FLGWSTAALG REAAMACTEA VETEIGSHYN DQVREILSWE       180
     ADAERRGEEL DEELKEMLAT FRRIRDEELE HLDHAVANDS KEAKPYDPLV DVIRFGCRAA       240
     IKISEKV                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page