(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE505

PENCW_16.PE505       Location/Qualifiers
FT   CDS             join(complement(1149022..1149082),
FT                   complement(1148706..1148968),complement(1148412..1148606))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000273094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672213"
FT                   /orf_name="Pc20g05050"
FT                   /product="Pc20g05050 protein"
FT                   /function="acid phosphatase activity"
FT                   /function="non-membrane spanning protein tyrosine
FT                   phosphatase activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85834.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0004726"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR002115"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="UniParc:UPI00018319F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEC9"
FT                   /transl_table=1
FT                   /translation="MTSNTNEHPTSVLFVCLGNICRSPMAEGVFRNLAATHPSIGEIDS
FT                   AGTAAYHSLEPPDSRTMSTLRRHKITGYDHAARKVTREDFLTFDYLLAMDKSNLRDLED
FT                   VRDSKVAEVRLFGDFGKGGKLHERVGGGEVVKDPYYGGANGFEEVYQQVTRFSQNFMEY
FT                   LEQNRSDSE"
     MTSNTNEHPT SVLFVCLGNI CRSPMAEGVF RNLAATHPSI GEIDSAGTAA YHSLEPPDSR        60
     TMSTLRRHKI TGYDHAARKV TREDFLTFDY LLAMDKSNLR DLEDVRDSKV AEVRLFGDFG       120
     KGGKLHERVG GGEVVKDPYY GGANGFEEVY QQVTRFSQNF MEYLEQNRSD SE               172
//

If you have problems or comments...

PBIL Back to PBIL home page