(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE51

PENCW_16.PE51        Location/Qualifiers
FT   CDS             join(complement(114651..114856),complement(114095..114554))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824090"
FT                   /orf_name="Pc20g00510"
FT                   /product="Putative uncharacterized protein Pc20g00510 "
FT                   /protein_id="CAP85380.1"
FT                   /db_xref="UniParc:UPI0001831AB5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFN9"
FT                   /transl_table=1
FT                   /translation="MSAATSSASTTHATGSLQDPTKLSSWVTEAQDAKKTPLLFSCIYG
FT                   IYLLGRIVVLLVANALKKRESQAEKDAKCSECPTARSRILELEQRVRIAELSARDANSR
FT                   AERFAVQVRRANELAEEFQRRAMAVEERVGDWRNFEFSANEVGSLHSPQTPSRHSPASS
FT                   AQSQPDSLKTQIKQSRVVSWTRSISRSVRRAVRPRRHKRSETLEAGQQFSKVRNSRSN"
     MSAATSSAST THATGSLQDP TKLSSWVTEA QDAKKTPLLF SCIYGIYLLG RIVVLLVANA        60
     LKKRESQAEK DAKCSECPTA RSRILELEQR VRIAELSARD ANSRAERFAV QVRRANELAE       120
     EFQRRAMAVE ERVGDWRNFE FSANEVGSLH SPQTPSRHSP ASSAQSQPDS LKTQIKQSRV       180
     VSWTRSISRS VRRAVRPRRH KRSETLEAGQ QFSKVRNSRS N                           221
//

If you have problems or comments...

PBIL Back to PBIL home page