(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE55

PENCW_16.PE55        Location/Qualifiers
FT   CDS             join(complement(127837..127928),complement(127738..127777),
FT                   complement(127137..127679),complement(126743..127084),
FT                   complement(126561..126695),complement(126441..126507),
FT                   complement(126253..126384),complement(125857..126206),
FT                   complement(125648..125793),complement(125485..125592),
FT                   complement(125126..125432),complement(124924..125077),
FT                   complement(124519..124851),complement(124381..124463),
FT                   complement(124198..124329),complement(123775..124131),
FT                   complement(123678..123723),complement(123529..123625),
FT                   complement(123274..123422),complement(123134..123213),
FT                   complement(122902..123098),complement(122771..122830),
FT                   complement(122508..122568))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946691"
FT                   /orf_name="Pc20g00550"
FT                   /product="Pc20g00550 protein"
FT                   /EC_number="3.6.3.8"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85384.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831AB9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP3"
FT                   /transl_table=1
FT                   /translation="MGSRPQSPSGTGPVDLSMPRNRLRRDSMRSSMSVVSDVEMARNEV
FT                   FDGPISESIPSSVVSFAHRRDRAGSTVSFTYFQDEEDFAEWSNEDEDVVDEEGEDDEES
FT                   LHGIRDPDLESARGSFVSKRMSTSRDSVEHPLLSRYLSASSYGRDRRSGSRLNQKVYIA
FT                   SEDLTAVFAGFSTSSGGFAVYIALCILTGGFAWLLFRWLPRWRVKLIGKATPIGKCQWV
FT                   AIEDQWNQFTIHGVDSQIYGRPLSTVFADSPSHGYDEDNDPNIDSLRFIDYRYLKFFYH
FT                   PIEDKFSLINGWKDPSWTNAKVMRSGLDADERDSREQIFGSNAIEIEQKTIPQLLVDEA
FT                   FHPFYIFQIASLVLWSMDEYYYYAVCIFLISFFSIATTVLETKSTMSRLREISLFECDV
FT                   RVLRNGFWRSVSSQELVPGDVYEFSDPSLHQVPCDCILLSGDSIVNESMLTGESVPVSK
FT                   TPLTDDALKYLDLSTPSIHPQVAKHFLFSGTKVIRARRPQNVDEDEAVALAVVMRTGFL
FT                   TTKGALVRSMLFPKPSGFKFYRDSFRYIAVMAIVALLGFVASFINFVRLGLAWHLIIIR
FT                   ALDLITIVVPPALPATLTIGTNFALSRLKKQNIFCISPQKVNVGGKLDIVCFDKTGTLT
FT                   EDGLDVLGARIVTRGKRFSELLSETSDGFLCPSQNVDSECDIEKQRNIMYAMATCHSLR
FT                   VVDDELLGDPLDVKMFQFTNWRFEEGGNHVSDQTNPKYDTIAPSVAKPPQRHIGDEQDV
FT                   NDSLELGVLRSFEFVSNLRRASVIVRKFGDNGASFFVKGAPESIKDICIPGTLPSDYED
FT                   LLNYYTHKGYRVIACASKYERKLSWMKAQKMTRTDAESDLEFLGFIIFENKLKPSTAGV
FT                   ISELNEAGIRNVMCTGDNILTAISVARECNMLGRDELCFIPHFIEEPGISSKISLIWEC
FT                   VDNPDLQLDPRTLLPMNDAEVDLSIPGNVLTEREYSVAVTGDAFRWLVDFGNEDVLKKV
FT                   LVCGKVFARMSPDEKHELVEKLQSIDYCCGFCGDGANDCGALKAADVGISLSDAEASVA
FT                   APFTSRLFEISCVPTVIKEGRAALVTSFSCFKFMSLYSAIQFSSVSFLYTSGSNLGDFQ
FT                   FLFIDLVLIMPIAVFMGWADPAPTLSRKRPTADLVSRKVLTPLLGQILFLPPQLDLEKS
FT                   NIVNSENTALFLFSCFQYIFISIVLSAGPPFRKPMTQNGPYLFTIIVNTMISGYMLFRP
FT                   SNWVSEMLATRASIRYLRSVLDSREEHIPTCGTDAWTRSCPLAAKLPQKAQDVQSAVGG
FT                   IAPMKYAFKAPTLGSASANRATELPFQKIEKKGGPKGASSPTERDHPSWPGT"
     MGSRPQSPSG TGPVDLSMPR NRLRRDSMRS SMSVVSDVEM ARNEVFDGPI SESIPSSVVS        60
     FAHRRDRAGS TVSFTYFQDE EDFAEWSNED EDVVDEEGED DEESLHGIRD PDLESARGSF       120
     VSKRMSTSRD SVEHPLLSRY LSASSYGRDR RSGSRLNQKV YIASEDLTAV FAGFSTSSGG       180
     FAVYIALCIL TGGFAWLLFR WLPRWRVKLI GKATPIGKCQ WVAIEDQWNQ FTIHGVDSQI       240
     YGRPLSTVFA DSPSHGYDED NDPNIDSLRF IDYRYLKFFY HPIEDKFSLI NGWKDPSWTN       300
     AKVMRSGLDA DERDSREQIF GSNAIEIEQK TIPQLLVDEA FHPFYIFQIA SLVLWSMDEY       360
     YYYAVCIFLI SFFSIATTVL ETKSTMSRLR EISLFECDVR VLRNGFWRSV SSQELVPGDV       420
     YEFSDPSLHQ VPCDCILLSG DSIVNESMLT GESVPVSKTP LTDDALKYLD LSTPSIHPQV       480
     AKHFLFSGTK VIRARRPQNV DEDEAVALAV VMRTGFLTTK GALVRSMLFP KPSGFKFYRD       540
     SFRYIAVMAI VALLGFVASF INFVRLGLAW HLIIIRALDL ITIVVPPALP ATLTIGTNFA       600
     LSRLKKQNIF CISPQKVNVG GKLDIVCFDK TGTLTEDGLD VLGARIVTRG KRFSELLSET       660
     SDGFLCPSQN VDSECDIEKQ RNIMYAMATC HSLRVVDDEL LGDPLDVKMF QFTNWRFEEG       720
     GNHVSDQTNP KYDTIAPSVA KPPQRHIGDE QDVNDSLELG VLRSFEFVSN LRRASVIVRK       780
     FGDNGASFFV KGAPESIKDI CIPGTLPSDY EDLLNYYTHK GYRVIACASK YERKLSWMKA       840
     QKMTRTDAES DLEFLGFIIF ENKLKPSTAG VISELNEAGI RNVMCTGDNI LTAISVAREC       900
     NMLGRDELCF IPHFIEEPGI SSKISLIWEC VDNPDLQLDP RTLLPMNDAE VDLSIPGNVL       960
     TEREYSVAVT GDAFRWLVDF GNEDVLKKVL VCGKVFARMS PDEKHELVEK LQSIDYCCGF      1020
     CGDGANDCGA LKAADVGISL SDAEASVAAP FTSRLFEISC VPTVIKEGRA ALVTSFSCFK      1080
     FMSLYSAIQF SSVSFLYTSG SNLGDFQFLF IDLVLIMPIA VFMGWADPAP TLSRKRPTAD      1140
     LVSRKVLTPL LGQILFLPPQ LDLEKSNIVN SENTALFLFS CFQYIFISIV LSAGPPFRKP      1200
     MTQNGPYLFT IIVNTMISGY MLFRPSNWVS EMLATRASIR YLRSVLDSRE EHIPTCGTDA      1260
     WTRSCPLAAK LPQKAQDVQS AVGGIAPMKY AFKAPTLGSA SANRATELPF QKIEKKGGPK      1320
     GASSPTERDH PSWPGT                                                      1336
//

If you have problems or comments...

PBIL Back to PBIL home page