(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE56

PENCW_16.PE56        Location/Qualifiers
FT   CDS             join(129123..129169,129251..129330,129393..130100,
FT                   130159..130499,130552..130602)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946692"
FT                   /orf_name="Pc20g00560"
FT                   /product="Pc20g00560 protein"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85385.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI0001831ABA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP4"
FT                   /transl_table=1
FT                   /translation="MSEPIRNKKADFPVAPTPQNTPANNAPISSHAQQPGVSSIEEESL
FT                   DKAAAASLFARNPALVSMIQGKLGQLVGRSSGYIESLPPSVRRRVAGLKGIQKEHSKLE
FT                   AQFQEEVLELEKKYFGKFTPLYQRRSTIINGGVEPTEAEVEAGKEDEESDEEETKEEPK
FT                   KEEAETANGIPEFWLSAMKNQISLAEMITERDEEALKHLTDIRMEYLDRPGFRLIFEFS
FT                   ENEFFTNKTISKTYFYKDESGYGGDFIYDHADGSQIDWKEDKDLTLRLESKKQRNKNTK
FT                   QTRVVKISVPTESFFNFFSPPQPPSEDDESVASDIEERLELDYQLGEDIKEKLIPRAID
FT                   WFTGEALQFEELGEDFDGDEFEDDDDEEEEDDEDEEDLGSDRDVDEEDTDEEDGTSKPK
FT                   KEAAECKQN"
     MSEPIRNKKA DFPVAPTPQN TPANNAPISS HAQQPGVSSI EEESLDKAAA ASLFARNPAL        60
     VSMIQGKLGQ LVGRSSGYIE SLPPSVRRRV AGLKGIQKEH SKLEAQFQEE VLELEKKYFG       120
     KFTPLYQRRS TIINGGVEPT EAEVEAGKED EESDEEETKE EPKKEEAETA NGIPEFWLSA       180
     MKNQISLAEM ITERDEEALK HLTDIRMEYL DRPGFRLIFE FSENEFFTNK TISKTYFYKD       240
     ESGYGGDFIY DHADGSQIDW KEDKDLTLRL ESKKQRNKNT KQTRVVKISV PTESFFNFFS       300
     PPQPPSEDDE SVASDIEERL ELDYQLGEDI KEKLIPRAID WFTGEALQFE ELGEDFDGDE       360
     FEDDDDEEEE DDEDEEDLGS DRDVDEEDTD EEDGTSKPKK EAAECKQN                    408
//

If you have problems or comments...

PBIL Back to PBIL home page