(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE57

PENCW_16.PE57        Location/Qualifiers
FT   CDS             join(131371..131505,131602..131734,131791..131980,
FT                   132039..135891,135944..136017,136075..136393)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946693"
FT                   /orf_name="Pc20g00570"
FT                   /product="Pc20g00570 protein"
FT                   /EC_number="3.6.4.1"
FT                   /function="ATP binding"
FT                   /function="actin filament binding"
FT                   /function="motor activity"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="CAP85386.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="GO:0051015"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR018444"
FT                   /db_xref="UniParc:UPI0001831ABB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG04"
FT                   /transl_table=1
FT                   /translation="MAHIYEVGTRAWQPDPTEGWLASEVKEKLEDGEKVQLIFELENGE
FT                   TKTVETTQSELQVDNNPKLPPLMNPAMLEASEDLTNLSHLNEPAVLQAIKLRYAQKEIY
FT                   TYSGIVLIATNPFARVDSLYVPQMVQVYAGKQRASQAPHLFAIAEEAFADMLRDGKNQT
FT                   IVVSGESGAGKTVSAKYIMRYFATRESSDQPGKYTTSRAEAISETEEQILATNPVMEAF
FT                   GNAKTTRNDNSSRFGKYIEIMFDDRTNIIGAKIRTYLLERSRLVFQPLKERNYHIFYQL
FT                   VAGASDAEKQELGLLATEDFEYLNQGGTPVIDGVDDKAEFEATRKSLAVIGVPKEDQTG
FT                   IFRVLAALLHLGNVKITATRTDSSVSSTEPSLLRACEMLGIDATEFAKWIVKKQLITRG
FT                   EKITSNLTQQQALVVRDSVSKFIYSSLFDWLVDKINRRLATDEVLEQFKCFIGVLDIYG
FT                   FEHFAKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVREEIDWTFIDFSDNQPCIDLI
FT                   EAKLGVLALLDEESRLPMGSDEQFVTKLHHHFAADKQKFYKKPRFGKSAFTVCHYAVDV
FT                   TYESDGFIEKNRDTVPDEHLEVLRNSSNPFIKEILDTAAAVREKDSASMSSKPVAAAPG
FT                   RRIGVAVNRKPTLGGIFKSSLIELMHTINNTEVHYIRCIKPNEAKEAWKFEGPMVLSQL
FT                   RACGVLETVRISTAGYPTRWTYEEFAIRYYMLCHSSQWTSEIRDMCHAILRKALGDEKQ
FT                   DKYQLGLTKIFFRAGMLAFLENLRTSRLNECAIMIQKNLRAKYYRRRYLDARDSILTTQ
FT                   AFIRGFLARQHAHEIRRTKAATTIQRVWRGQKEKKRYTQIRKNFILFESVAKGFLCRRN
FT                   IMDSINGNAAKVIQRAFRSWRQLRAWRQYRRKVITIQNLWRGKEARNAYKRLREDARDL
FT                   KQISYKLENKVVELTQYLQTLKLENKTLVSQLDNYDTQLKSWRTRHNALEARTKELQVE
FT                   ANQAGITAARLEAIEEEMSKLQQGHTEAQATIKRLQEEERISREALQTANEELERLKLL
FT                   DADHEKDKTALRQRISDLEEQLEVAKRSVPLNGMNGDGLPNGGAVQTPTPGLINLVSSK
FT                   KPKPKRRSAGAERIETDRFSGAYNPRPVSMAVTPGSMATRQSAAISPGLESVEVELENL
FT                   LSEEEDLNEEVAMGLIRNLKIPLPTSTPPPTEKEVLFPAYLINLVTSEMWNNGFVKESE
FT                   RFLANVMQSIQQEVMQHDGDDAINPGAFWLSNVHEMLSFVFLAEDWYEAQKTENYEYDR
FT                   LLEIVKHDLESLEFNIYHTWMKVLKKKLYKMIVPAIIESQSLPGFVTSETNRFLGKLLP
FT                   SNNNPAYSMDNLLSLLNGVYKAMKAFYLEDAIILQTVTELLRLVGVTAFNDLLMRRNFL
FT                   SWKRGLQINYNITRIEEWCKSHDMPEGTLKLEHLMQATKLLQLKKATLNDIEIIQDICW
FT                   MLSPNQIQKLLNQYLVADYEQPINGEIMKAVASRVTEKSDVLLLAPVDMEDSGPYEIAE
FT                   PRVITALETYTPSWLQTPRLKRLAEIVSAQAMAQQEKLDWDNGVVEE"
     MAHIYEVGTR AWQPDPTEGW LASEVKEKLE DGEKVQLIFE LENGETKTVE TTQSELQVDN        60
     NPKLPPLMNP AMLEASEDLT NLSHLNEPAV LQAIKLRYAQ KEIYTYSGIV LIATNPFARV       120
     DSLYVPQMVQ VYAGKQRASQ APHLFAIAEE AFADMLRDGK NQTIVVSGES GAGKTVSAKY       180
     IMRYFATRES SDQPGKYTTS RAEAISETEE QILATNPVME AFGNAKTTRN DNSSRFGKYI       240
     EIMFDDRTNI IGAKIRTYLL ERSRLVFQPL KERNYHIFYQ LVAGASDAEK QELGLLATED       300
     FEYLNQGGTP VIDGVDDKAE FEATRKSLAV IGVPKEDQTG IFRVLAALLH LGNVKITATR       360
     TDSSVSSTEP SLLRACEMLG IDATEFAKWI VKKQLITRGE KITSNLTQQQ ALVVRDSVSK       420
     FIYSSLFDWL VDKINRRLAT DEVLEQFKCF IGVLDIYGFE HFAKNSFEQF CINYANEKLQ       480
     QEFNQHVFKL EQEEYVREEI DWTFIDFSDN QPCIDLIEAK LGVLALLDEE SRLPMGSDEQ       540
     FVTKLHHHFA ADKQKFYKKP RFGKSAFTVC HYAVDVTYES DGFIEKNRDT VPDEHLEVLR       600
     NSSNPFIKEI LDTAAAVREK DSASMSSKPV AAAPGRRIGV AVNRKPTLGG IFKSSLIELM       660
     HTINNTEVHY IRCIKPNEAK EAWKFEGPMV LSQLRACGVL ETVRISTAGY PTRWTYEEFA       720
     IRYYMLCHSS QWTSEIRDMC HAILRKALGD EKQDKYQLGL TKIFFRAGML AFLENLRTSR       780
     LNECAIMIQK NLRAKYYRRR YLDARDSILT TQAFIRGFLA RQHAHEIRRT KAATTIQRVW       840
     RGQKEKKRYT QIRKNFILFE SVAKGFLCRR NIMDSINGNA AKVIQRAFRS WRQLRAWRQY       900
     RRKVITIQNL WRGKEARNAY KRLREDARDL KQISYKLENK VVELTQYLQT LKLENKTLVS       960
     QLDNYDTQLK SWRTRHNALE ARTKELQVEA NQAGITAARL EAIEEEMSKL QQGHTEAQAT      1020
     IKRLQEEERI SREALQTANE ELERLKLLDA DHEKDKTALR QRISDLEEQL EVAKRSVPLN      1080
     GMNGDGLPNG GAVQTPTPGL INLVSSKKPK PKRRSAGAER IETDRFSGAY NPRPVSMAVT      1140
     PGSMATRQSA AISPGLESVE VELENLLSEE EDLNEEVAMG LIRNLKIPLP TSTPPPTEKE      1200
     VLFPAYLINL VTSEMWNNGF VKESERFLAN VMQSIQQEVM QHDGDDAINP GAFWLSNVHE      1260
     MLSFVFLAED WYEAQKTENY EYDRLLEIVK HDLESLEFNI YHTWMKVLKK KLYKMIVPAI      1320
     IESQSLPGFV TSETNRFLGK LLPSNNNPAY SMDNLLSLLN GVYKAMKAFY LEDAIILQTV      1380
     TELLRLVGVT AFNDLLMRRN FLSWKRGLQI NYNITRIEEW CKSHDMPEGT LKLEHLMQAT      1440
     KLLQLKKATL NDIEIIQDIC WMLSPNQIQK LLNQYLVADY EQPINGEIMK AVASRVTEKS      1500
     DVLLLAPVDM EDSGPYEIAE PRVITALETY TPSWLQTPRL KRLAEIVSAQ AMAQQEKLDW      1560
     DNGVVEE                                                                1567
//

If you have problems or comments...

PBIL Back to PBIL home page