(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE58

PENCW_16.PE58        Location/Qualifiers
FT   CDS             join(complement(136942..137068),complement(136638..136827),
FT                   complement(136435..136570))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946694"
FT                   /orf_name="Pc20g00580"
FT                   /product="Putative uncharacterized protein Pc20g00580 "
FT                   /protein_id="CAP85387.1"
FT                   /db_xref="UniParc:UPI0001831ABC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG05"
FT                   /transl_table=1
FT                   /translation="MTPDDLVWEQAEEIFDKWLLQFLQHDVLRPIGAFIITHERGFGGK
FT                   GGDGIDSRSKVDGDGHQGSIYRGIQMSTLTFHEQFESQEKAKVENSLEKRMDSEPTHDE
FT                   TSHLQQFPEQSLLVYKPRRHMQLKQMKIMRITVSQRPWIIQASRNP"
     MTPDDLVWEQ AEEIFDKWLL QFLQHDVLRP IGAFIITHER GFGGKGGDGI DSRSKVDGDG        60
     HQGSIYRGIQ MSTLTFHEQF ESQEKAKVEN SLEKRMDSEP THDETSHLQQ FPEQSLLVYK       120
     PRRHMQLKQM KIMRITVSQR PWIIQASRNP                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page