(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE59

PENCW_16.PE59        Location/Qualifiers
FT   CDS             join(137402..137572,137628..137701,137758..137902,
FT                   137956..137992,138054..138118,138171..138239)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000293320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824092"
FT                   /orf_name="Pc20g00590"
FT                   /product="Pc20g00590 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP85388.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniParc:UPI0001831ABD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG06"
FT                   /transl_table=1
FT                   /translation="MTLTKLNFITGNKNKLLEVRAILGKVIEVDNQEVDVPEIQGTIEE
FT                   IAKEKARRAAEAINGPALTEDTALEFHALKGLPGPYIKSFMEKLGHEGLNKMLDGFEDR
FT                   TAEAVCTFAFCRGPGEEPIVFQGRTEGAIVRPRGSGNFGWDAIFEYDGKQTYAEMDKEE
FT                   KNKISHRYKALVKLQQWLAEGQQ"
     MTLTKLNFIT GNKNKLLEVR AILGKVIEVD NQEVDVPEIQ GTIEEIAKEK ARRAAEAING        60
     PALTEDTALE FHALKGLPGP YIKSFMEKLG HEGLNKMLDG FEDRTAEAVC TFAFCRGPGE       120
     EPIVFQGRTE GAIVRPRGSG NFGWDAIFEY DGKQTYAEMD KEEKNKISHR YKALVKLQQW       180
     LAEGQQ                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page