(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE6

PENCW_16.PE6         Location/Qualifiers
FT   CDS             join(complement(22174..22409),complement(21371..22115))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946671"
FT                   /orf_name="Pc20g00060"
FT                   /product="Pc20g00060 protein"
FT                   /protein_id="CAP85335.1"
FT                   /db_xref="UniParc:UPI000183182C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER4"
FT                   /transl_table=1
FT                   /translation="MYYARPAALSAVLLQVLPTLAAPAPGGSGNPGEWSQDGFWGSPGH
FT                   GDSAGIGPGGFDNSHCGHNANGNNVGSTVTVTDCPATPTATVTVTIDGDGNGSATVTET
FT                   ISACTATVTTGDDGRSASTTTETETVISTISSCTATTTDITTLTEDGPTVTTTVTTPGP
FT                   VSTTTEFVGTSTVTEPGVTEYETVTDTITHTDTSTVTNNQVVTSTVTSTETQTLQVTTT
FT                   VTADDCSNTGTSDDLDYGSCSDPTINWLYGLDGRTEYSYTTNNQDDFPFGSSPTIDSPA
FT                   DLICNRLRSPCNAPQATIDQCYAAESAVASLSGQEAADTWNDLMT"
     MYYARPAALS AVLLQVLPTL AAPAPGGSGN PGEWSQDGFW GSPGHGDSAG IGPGGFDNSH        60
     CGHNANGNNV GSTVTVTDCP ATPTATVTVT IDGDGNGSAT VTETISACTA TVTTGDDGRS       120
     ASTTTETETV ISTISSCTAT TTDITTLTED GPTVTTTVTT PGPVSTTTEF VGTSTVTEPG       180
     VTEYETVTDT ITHTDTSTVT NNQVVTSTVT STETQTLQVT TTVTADDCSN TGTSDDLDYG       240
     SCSDPTINWL YGLDGRTEYS YTTNNQDDFP FGSSPTIDSP ADLICNRLRS PCNAPQATID       300
     QCYAAESAVA SLSGQEAADT WNDLMT                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page