(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE60

PENCW_16.PE60        Location/Qualifiers
FT   CDS             join(complement(138844..139026),complement(138591..138739),
FT                   complement(138331..138532))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224472" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946695"
FT                   /orf_name="Pc20g00600"
FT                   /product="Pc20g00600 protein"
FT                   /function="ATP binding"
FT                   /protein_id="CAP85389.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI0001831B89"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG07"
FT                   /transl_table=1
FT                   /translation="MRTSPNVIITGTPGVGKTVHCEQLAQEIGLKHLSINQVAKDRGCF
FT                   DEYDEELKTWVVDEDKLLDALEDEIPNGGYLIDWHACDLFPKSWIDLVVVLRCPTTDVL
FT                   YDRLSSRGYHEKKLEENVDAEIFGVLADEAREAFDEEIVVELNSEQDSDVDSNCQRIAQ
FT                   WVDSWKQSQAENAD"
     MRTSPNVIIT GTPGVGKTVH CEQLAQEIGL KHLSINQVAK DRGCFDEYDE ELKTWVVDED        60
     KLLDALEDEI PNGGYLIDWH ACDLFPKSWI DLVVVLRCPT TDVLYDRLSS RGYHEKKLEE       120
     NVDAEIFGVL ADEAREAFDE EIVVELNSEQ DSDVDSNCQR IAQWVDSWKQ SQAENAD          177
//

If you have problems or comments...

PBIL Back to PBIL home page