(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE61

PENCW_16.PE61        Location/Qualifiers
FT   CDS             join(complement(139895..140326),complement(139811..139842),
FT                   complement(139606..139760),complement(139347..139551),
FT                   complement(139261..139297))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235067" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946696"
FT                   /orf_name="Pc20g00610"
FT                   /product="Pc20g00610 protein"
FT                   /protein_id="CAP85390.1"
FT                   /db_xref="InterPro:IPR012462"
FT                   /db_xref="UniParc:UPI0001831B8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG08"
FT                   /transl_table=1
FT                   /translation="MPSWLKKMLGKGGNISKQTQITSDGKLTRRKTVENETDHLIPVLA
FT                   RLCEQDNSVQRAFLCSPKVRHICKMRREGGFCGYRNIQMMVSWVKKSGSFGHEHFPKEG
FT                   PTILELQDMIESAWDMGFNSSGRVETGGIKDTRKFIGTPEAQALFMSLGIPCEARSLPE
FT                   RSDVRACDALYIDVADYFRSACPPEDETKVIQTDLPPIYFQHQGHSMTIVGFEIRDNGS
FT                   ANLLVFDPMFKTSPAMERLIGAFVKPSDPTRLLKAYRRGTPYLQKYKIFELLKLCITSP
FT                   KQDAT"
     MPSWLKKMLG KGGNISKQTQ ITSDGKLTRR KTVENETDHL IPVLARLCEQ DNSVQRAFLC        60
     SPKVRHICKM RREGGFCGYR NIQMMVSWVK KSGSFGHEHF PKEGPTILEL QDMIESAWDM       120
     GFNSSGRVET GGIKDTRKFI GTPEAQALFM SLGIPCEARS LPERSDVRAC DALYIDVADY       180
     FRSACPPEDE TKVIQTDLPP IYFQHQGHSM TIVGFEIRDN GSANLLVFDP MFKTSPAMER       240
     LIGAFVKPSD PTRLLKAYRR GTPYLQKYKI FELLKLCITS PKQDAT                      286
//

If you have problems or comments...

PBIL Back to PBIL home page