(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE62

PENCW_16.PE62        Location/Qualifiers
FT   CDS             complement(140374..140913)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946697"
FT                   /orf_name="Pc20g00620"
FT                   /product="Pc20g00620 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85391.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831B8B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG09"
FT                   /transl_table=1
FT                   /translation="MTDNNTASCPFCPFTDSDAGFVSQHIEFCHPETGVTGFLEETPQE
FT                   FTAQNPAPLPVDEDGADKYVDCPHGCGETIEIAELSSHLDLHVAEDMALDDIGATSARS
FT                   TPDAHGHEYDETFDDEDPLDMLESYKGGKRGMQRDSTRANTAKPPRPHSPPRTINADGI
FT                   KRLGVFVSYLHFKDKY"
     MTDNNTASCP FCPFTDSDAG FVSQHIEFCH PETGVTGFLE ETPQEFTAQN PAPLPVDEDG        60
     ADKYVDCPHG CGETIEIAEL SSHLDLHVAE DMALDDIGAT SARSTPDAHG HEYDETFDDE       120
     DPLDMLESYK GGKRGMQRDS TRANTAKPPR PHSPPRTINA DGIKRLGVFV SYLHFKDKY        179
//

If you have problems or comments...

PBIL Back to PBIL home page