(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE63

PENCW_16.PE63        Location/Qualifiers
FT   CDS             join(complement(143385..143935),complement(142882..143325),
FT                   complement(142234..142638),complement(141272..142169))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234943" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946698"
FT                   /orf_name="Pc20g00630"
FT                   /product="Pc20g00630 protein"
FT                   /protein_id="CAP85392.1"
FT                   /db_xref="UniParc:UPI0001831B8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG10"
FT                   /transl_table=1
FT                   /translation="MFHKRQEHDAEETTRKSRSLWIFRSWSWFPNYAKEPEMQQLTVHS
FT                   DPVRKWIKGVVICSWIIGGVLALNIILTVVAAGLAYSGNSGQMFDFASLYMGKCSTSKY
FT                   WTTGLHLLINILSTALLGASNYCMQCLAAPSREQVDEAHSQKTWVRIGVPNIMDLLRYQ
FT                   TGRRRLLGSILLITSLPIHLIYNSAVYFSIGPTEYSIVAAQDKLIQEHGNSTEFEQCFT
FT                   ENVGMDLPSFNAAIRDGRFNTLSKQECIDIFAQDYASGYGTVVLVTKDPMPQNESVALV
FT                   GTGNRHSFEGGFSQFSWLCDEEYPCTKSIAEEDTQDWSVDALTWSRPTIHLTARSYSID
FT                   HCMTLPVEETCQLFFSPLICLVVIGCNLVKLICALLAARENRKDIFLTTGDAIASFLAK
FT                   PDPATEGVCLLSGSLVKKRTQGWRKYKGRERKSLDLLETKQESPLRLPSRKRWFQAASV
FT                   SRWVYTVLLFVCMLVPSVIVLRLGILNYNKASKSKSIWDSGLGEASSGTTLAGLSISAT
FT                   STGIFSMILMANIPQILVSLAYFFYNGLLTCMLGAVEYDNYATKRKPLRVSWPRGAQRS
FT                   TYYLTLPYRYSIPLLIVSAVLHWLVSQSFFFVQVIPFDRHGVPQERYPEVLVTCGYSPV
FT                   AIIFGIIVGGLLPVVAALMGLRRFRSHMPLAGQCSAAISAACHPMTTAVDHALKPVQWG
FT                   EVPGSVLSHSGFLNTITTDIECDARSSVGSDEQRLPLARELDRNDSRAVGFLHCTFTSE
FT                   DVSEPSTSHLYL"
     MFHKRQEHDA EETTRKSRSL WIFRSWSWFP NYAKEPEMQQ LTVHSDPVRK WIKGVVICSW        60
     IIGGVLALNI ILTVVAAGLA YSGNSGQMFD FASLYMGKCS TSKYWTTGLH LLINILSTAL       120
     LGASNYCMQC LAAPSREQVD EAHSQKTWVR IGVPNIMDLL RYQTGRRRLL GSILLITSLP       180
     IHLIYNSAVY FSIGPTEYSI VAAQDKLIQE HGNSTEFEQC FTENVGMDLP SFNAAIRDGR       240
     FNTLSKQECI DIFAQDYASG YGTVVLVTKD PMPQNESVAL VGTGNRHSFE GGFSQFSWLC       300
     DEEYPCTKSI AEEDTQDWSV DALTWSRPTI HLTARSYSID HCMTLPVEET CQLFFSPLIC       360
     LVVIGCNLVK LICALLAARE NRKDIFLTTG DAIASFLAKP DPATEGVCLL SGSLVKKRTQ       420
     GWRKYKGRER KSLDLLETKQ ESPLRLPSRK RWFQAASVSR WVYTVLLFVC MLVPSVIVLR       480
     LGILNYNKAS KSKSIWDSGL GEASSGTTLA GLSISATSTG IFSMILMANI PQILVSLAYF       540
     FYNGLLTCML GAVEYDNYAT KRKPLRVSWP RGAQRSTYYL TLPYRYSIPL LIVSAVLHWL       600
     VSQSFFFVQV IPFDRHGVPQ ERYPEVLVTC GYSPVAIIFG IIVGGLLPVV AALMGLRRFR       660
     SHMPLAGQCS AAISAACHPM TTAVDHALKP VQWGEVPGSV LSHSGFLNTI TTDIECDARS       720
     SVGSDEQRLP LARELDRNDS RAVGFLHCTF TSEDVSEPST SHLYL                       765
//

If you have problems or comments...

PBIL Back to PBIL home page