(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE67

PENCW_16.PE67        Location/Qualifiers
FT   CDS             join(154391..154490,154624..154799)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977337"
FT                   /orf_name="Pc20g00670"
FT                   /product="Pc20g00670 protein"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAP85396.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI0001831B90"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG14"
FT                   /transl_table=1
FT                   /translation="MEQQLDLTKLSESDKKELNQVLTNEAQKSNIQQTVHHLNEVCWEK
FT                   CITSKITSGTLDKSEEACAQNCVDRWMDTSLSILSKLDSMRGGPGH"
     MEQQLDLTKL SESDKKELNQ VLTNEAQKSN IQQTVHHLNE VCWEKCITSK ITSGTLDKSE        60
     EACAQNCVDR WMDTSLSILS KLDSMRGGPG H                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page