(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE68

PENCW_16.PE68        Location/Qualifiers
FT   CDS             join(complement(156451..156475),complement(156071..156120),
FT                   complement(155712..155998),complement(155566..155653))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671393"
FT                   /orf_name="Pc20g00680"
FT                   /product="Pc20g00680 protein"
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85397.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniParc:UPI0001831B91"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG15"
FT                   /transl_table=1
FT                   /translation="MAPTDNKTGKNKANAAAKAVAKGASLHKSRKVRTSSTFHRPKTLQ
FT                   LSRSPKYPRVSVNHGPALDFNKIVLYPLNTESAMKKIEENNTLVFIVNVKSNKRQIKQA
FT                   LKKLYDVDTVKINTLIRPDGTKKAFARLTPDVDALDIAATKLAIV"
     MAPTDNKTGK NKANAAAKAV AKGASLHKSR KVRTSSTFHR PKTLQLSRSP KYPRVSVNHG        60
     PALDFNKIVL YPLNTESAMK KIEENNTLVF IVNVKSNKRQ IKQALKKLYD VDTVKINTLI       120
     RPDGTKKAFA RLTPDVDALD IAATKLAIV                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page