(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE69

PENCW_16.PE69        Location/Qualifiers
FT   CDS             156841..157692
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946700"
FT                   /orf_name="Pc20g00690"
FT                   /product="Pc20g00690 protein"
FT                   /protein_id="CAP85398.1"
FT                   /db_xref="InterPro:IPR021867"
FT                   /db_xref="UniParc:UPI0001831B92"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG16"
FT                   /transl_table=1
FT                   /translation="MAPQKRSKRPMLLSHSRPRIVKSKDAALSAKATRTLIRTHHRLLK
FT                   VRAQALAAGDEARVSSIDAQIEANGGLESYQIASKLGQSMDRGGDSSKVLIDWIKPQLK
FT                   QWNKAIPKLRVLEVGALSTKNACSTHPALDVTRIDLNSQEPGILKQDFMERPLPSSDDE
FT                   RFNIISLSLVLNYVPDATGRGEMLKHCVKFLTSKCPIELVPSLFMVLPIACVDNSRYLN
FT                   EERLGEILTCLGFRLAQSKRTSKLVFHLWEHTGTYAPKAFKKEELRSGKTRNNFAVILN
FT                   KK"
     MAPQKRSKRP MLLSHSRPRI VKSKDAALSA KATRTLIRTH HRLLKVRAQA LAAGDEARVS        60
     SIDAQIEANG GLESYQIASK LGQSMDRGGD SSKVLIDWIK PQLKQWNKAI PKLRVLEVGA       120
     LSTKNACSTH PALDVTRIDL NSQEPGILKQ DFMERPLPSS DDERFNIISL SLVLNYVPDA       180
     TGRGEMLKHC VKFLTSKCPI ELVPSLFMVL PIACVDNSRY LNEERLGEIL TCLGFRLAQS       240
     KRTSKLVFHL WEHTGTYAPK AFKKEELRSG KTRNNFAVIL NKK                         283
//

If you have problems or comments...

PBIL Back to PBIL home page