(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE7

PENCW_16.PE7         Location/Qualifiers
FT   CDS             join(22478..22653,22684..22818,23041..23110,23218..23382)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946672"
FT                   /orf_name="Pc20g00070"
FT                   /product="Putative uncharacterized protein Pc20g00070 "
FT                   /protein_id="CAP85336.1"
FT                   /db_xref="UniParc:UPI000183182D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER5"
FT                   /transl_table=1
FT                   /translation="MGLCRSSPYRNRRLKECDVDDLENNGEDAQLYTLASMLNYITGRS
FT                   HLPIRHFENKGTQSFKNVNSHGSSWEHAAGYFIRMKYPWSLRPITTGLVLEGRGDGIVR
FT                   KIKESRVIMAWIHAKRAPTGITKYGLYHEMEKTPELKLCKNMIAMGWKGGSWVRRLGHI
FT                   PELPNCSFFGERAMVLSM"
     MGLCRSSPYR NRRLKECDVD DLENNGEDAQ LYTLASMLNY ITGRSHLPIR HFENKGTQSF        60
     KNVNSHGSSW EHAAGYFIRM KYPWSLRPIT TGLVLEGRGD GIVRKIKESR VIMAWIHAKR       120
     APTGITKYGL YHEMEKTPEL KLCKNMIAMG WKGGSWVRRL GHIPELPNCS FFGERAMVLS       180
     M                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page