(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE70

PENCW_16.PE70        Location/Qualifiers
FT   CDS             join(complement(159741..159892),complement(158717..159687),
FT                   complement(158538..158666),complement(158388..158485),
FT                   complement(158171..158337),complement(157751..158120))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946701"
FT                   /orf_name="Pc20g00700"
FT                   /product="Pc20g00700 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85399.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI0001831B93"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG17"
FT                   /transl_table=1
FT                   /translation="MSRAERTDEDLDNEPVYGSLRIPAAAPSSYDYGHLNSGSPTAESE
FT                   IGGRQRSSSYSIRVRQAGGPNSIDNFARSWQRAAAFPEILPRRSSFVSAHSDDELAIAT
FT                   GQEYGSRSSPSWGRHSDVERPLLRGDSDSDQDDGDTRAPESSKRALPSTGLLSSSFDRS
FT                   FANSYGTISSRVSESTRRHAIQFHREHHPQVHVDGSGDSDRGPLLIKHVQHEDGTEEDI
FT                   VVGQSTLPQTIFNSVNVLIGIGLLSLPLAMKHAGWVLGLVFLIFSAVATSYTAKILAKC
FT                   LDVDRSVVTYADLAYISFGQHARLITSFLFCLELLGACVALVVLFADSLYALVPGLSIL
FT                   QWKIVCGVVLLPLNFLPLRFLSITSILGIISCTSIVVLICIDGFIKPDAPGSLRQPANT
FT                   FLFPENWATVPLSFGLIMSPWGGHGVFPNIYRDMRHPQKYGKSLWVTYIFTFALDCSMA
FT                   IIGWLMFGDIIRDEVTANILTITDYPQSLSVCIVVFISIIPLTKVPLNARPLVATFEVL
FT                   CGLGGGHVPAENGSKTLQKVSRAMVRVFVVATIVILAIVFPAFDRIMAFLGSFLCFTIC
FT                   IIFPLAFYLKIFGKEIGRGEYILDWVLLIVSSILAAVGTVWAFLPQDMLSAN"
     MSRAERTDED LDNEPVYGSL RIPAAAPSSY DYGHLNSGSP TAESEIGGRQ RSSSYSIRVR        60
     QAGGPNSIDN FARSWQRAAA FPEILPRRSS FVSAHSDDEL AIATGQEYGS RSSPSWGRHS       120
     DVERPLLRGD SDSDQDDGDT RAPESSKRAL PSTGLLSSSF DRSFANSYGT ISSRVSESTR       180
     RHAIQFHREH HPQVHVDGSG DSDRGPLLIK HVQHEDGTEE DIVVGQSTLP QTIFNSVNVL       240
     IGIGLLSLPL AMKHAGWVLG LVFLIFSAVA TSYTAKILAK CLDVDRSVVT YADLAYISFG       300
     QHARLITSFL FCLELLGACV ALVVLFADSL YALVPGLSIL QWKIVCGVVL LPLNFLPLRF       360
     LSITSILGII SCTSIVVLIC IDGFIKPDAP GSLRQPANTF LFPENWATVP LSFGLIMSPW       420
     GGHGVFPNIY RDMRHPQKYG KSLWVTYIFT FALDCSMAII GWLMFGDIIR DEVTANILTI       480
     TDYPQSLSVC IVVFISIIPL TKVPLNARPL VATFEVLCGL GGGHVPAENG SKTLQKVSRA       540
     MVRVFVVATI VILAIVFPAF DRIMAFLGSF LCFTICIIFP LAFYLKIFGK EIGRGEYILD       600
     WVLLIVSSIL AAVGTVWAFL PQDMLSAN                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page