(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE71

PENCW_16.PE71        Location/Qualifiers
FT   CDS             join(160884..161004,161059..161108,161167..161538,
FT                   161593..162349,162423..162572,162630..162661,1
FT                   62691..162696)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946702"
FT                   /orf_name="Pc20g00710"
FT                   /product="Pc20g00710 protein"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85400.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI0001831B94"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG18"
FT                   /transl_table=1
FT                   /translation="MSAPPPNEAEKNIEIWKVKKLIKRLESARGNGTSMISLIIPPKDQ
FT                   ISRAAKMLAEEYGTASNIKSRVNRLSVLSAITSTQQRLKLYNKVPPNGLVVYCGEIITS
FT                   EGKERKINIDFEPFKPINTSLYLCDNKFHTEALSELLEADQKFGFIVMDGNGTLFGTLS
FT                   GNTREILQRLTVDLPKKHGRGGQSALRFSRLREEKRHNYVRKIAELAVQNYITNDKPNV
FT                   AGLVLAGSADFKNDLNQSDLFDGRLQSKVIKVVDVSYGGENGFNQAIELAGETLSNVKF
FT                   VQEKKLIGQYFQEISQDTGRVCYGIEDTLKAMELGAAEILIVHENLEITRWVMKNAAGN
FT                   QVIVHTNKVQESQKDLFQDKETGLDMEVVESGSFLEWLAEAYKDFGANLEFVSDRSGEG
FT                   NQFVKGFGGIGAILRYKVNFEQLADLSDDDEFYDESEDERPEAPAASLLTARPVDHASG
FT                   SRDGTKASVKDNQKRPGPRSLKLLRVSSKLQGTHTEV"
     MSAPPPNEAE KNIEIWKVKK LIKRLESARG NGTSMISLII PPKDQISRAA KMLAEEYGTA        60
     SNIKSRVNRL SVLSAITSTQ QRLKLYNKVP PNGLVVYCGE IITSEGKERK INIDFEPFKP       120
     INTSLYLCDN KFHTEALSEL LEADQKFGFI VMDGNGTLFG TLSGNTREIL QRLTVDLPKK       180
     HGRGGQSALR FSRLREEKRH NYVRKIAELA VQNYITNDKP NVAGLVLAGS ADFKNDLNQS       240
     DLFDGRLQSK VIKVVDVSYG GENGFNQAIE LAGETLSNVK FVQEKKLIGQ YFQEISQDTG       300
     RVCYGIEDTL KAMELGAAEI LIVHENLEIT RWVMKNAAGN QVIVHTNKVQ ESQKDLFQDK       360
     ETGLDMEVVE SGSFLEWLAE AYKDFGANLE FVSDRSGEGN QFVKGFGGIG AILRYKVNFE       420
     QLADLSDDDE FYDESEDERP EAPAASLLTA RPVDHASGSR DGTKASVKDN QKRPGPRSLK       480
     LLRVSSKLQG THTEV                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page