(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE72

PENCW_16.PE72        Location/Qualifiers
FT   CDS             join(complement(164091..164144),complement(163128..164027))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946703"
FT                   /orf_name="Pc20g00720"
FT                   /product="Pc20g00720 protein"
FT                   /function="prephenate dehydratase activity"
FT                   /biological_process="L-phenylalanine biosynthetic process "
FT                   /protein_id="CAP85401.1"
FT                   /db_xref="GO:0004664"
FT                   /db_xref="GO:0009094"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="UniParc:UPI0001831B95"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG19"
FT                   /transl_table=1
FT                   /translation="MAPFKVAFLGPLGSFSHQAAAESFCKLSADLQPQVSFPDAFAALQ
FT                   KKEVDYAVIPCENSTNGSVMQTLDLLADRDGSYKDVKVCGEYYLTVHHFLMVRKGTYPG
FT                   GWAEYDGSITKLYTHPQAWGQCEAFLTKYFKGIERQDVTSTSKAAEIVSKETTERGAAI
FT                   ANRFAAEQHGTDVLVENIEDRADNTTRFLIFRNVLDERTSEFKFEQPNPPTLEGELALE
FT                   TTHKTLISFTIDHSSPGALANALLIFKAHGLNLTSINTRPSLKKPWQYIFFVECGRTPS
FT                   DENKEAVHKALNDLRQVTETCRDLGTWKDQLSASNA"
     MAPFKVAFLG PLGSFSHQAA AESFCKLSAD LQPQVSFPDA FAALQKKEVD YAVIPCENST        60
     NGSVMQTLDL LADRDGSYKD VKVCGEYYLT VHHFLMVRKG TYPGGWAEYD GSITKLYTHP       120
     QAWGQCEAFL TKYFKGIERQ DVTSTSKAAE IVSKETTERG AAIANRFAAE QHGTDVLVEN       180
     IEDRADNTTR FLIFRNVLDE RTSEFKFEQP NPPTLEGELA LETTHKTLIS FTIDHSSPGA       240
     LANALLIFKA HGLNLTSINT RPSLKKPWQY IFFVECGRTP SDENKEAVHK ALNDLRQVTE       300
     TCRDLGTWKD QLSASNA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page