(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE73

PENCW_16.PE73        Location/Qualifiers
FT   CDS             join(164406..165090,165156..165532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946704"
FT                   /orf_name="Pc20g00730"
FT                   /product="Pc20g00730 protein"
FT                   /protein_id="CAP85402.1"
FT                   /db_xref="UniParc:UPI0001831B96"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC4"
FT                   /transl_table=1
FT                   /translation="MKTNPLRPLISLRGGRHACRTYSSLSERLHYELTTRKLPLTYDYL
FT                   HPQPSHLLNLTLRDLLPQSKNSSGYATLPTLQNPSPLPVGHHLIYFPPQVTLSQLLPDC
FT                   TDTLHTPGEPFNRRLWAGGNLRFPVRSPPLDGSRAVCIESIRNVTVKGREGDEKVTVTI
FT                   ERRIGNVAEQETAEETWERIWKENEDNSGESSVIENRDLIFMRLKTSAQIEADKAQFGK
FT                   PGRTVKPPSGATFRHALIPTKALLFRFSALTFNAHSIHLDKSYTQNQEGYPNLLVHGPL
FT                   TLTLLLSVLQQQLSRLNLCISDIEYKNIAPLFVEQELVICGKPKNDTGAWDVWIEGPDG
FT                   GLAVRGTARTRLE"
     MKTNPLRPLI SLRGGRHACR TYSSLSERLH YELTTRKLPL TYDYLHPQPS HLLNLTLRDL        60
     LPQSKNSSGY ATLPTLQNPS PLPVGHHLIY FPPQVTLSQL LPDCTDTLHT PGEPFNRRLW       120
     AGGNLRFPVR SPPLDGSRAV CIESIRNVTV KGREGDEKVT VTIERRIGNV AEQETAEETW       180
     ERIWKENEDN SGESSVIENR DLIFMRLKTS AQIEADKAQF GKPGRTVKPP SGATFRHALI       240
     PTKALLFRFS ALTFNAHSIH LDKSYTQNQE GYPNLLVHGP LTLTLLLSVL QQQLSRLNLC       300
     ISDIEYKNIA PLFVEQELVI CGKPKNDTGA WDVWIEGPDG GLAVRGTART RLE              353
//

If you have problems or comments...

PBIL Back to PBIL home page