(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE74

PENCW_16.PE74        Location/Qualifiers
FT   CDS             join(165868..165902,165957..166135,166194..166279,
FT                   166655..166697,166751..167178)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824094"
FT                   /orf_name="Pc20g00740"
FT                   /product="Pc20g00740 protein"
FT                   /protein_id="CAP85403.1"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI0001831B97"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC5"
FT                   /transl_table=1
FT                   /translation="MDVFWAAPPVTRTLTALTLVQSALMYGGLLSFYWAPFLPSLIFSW
FT                   RPQIYRLVTPFLLTGPKLGFFFDLYIMYRYGSAAEKSMAPGEFLIYLLFVAFSIMLTAG
FT                   GYLGAAILLPPLTMAFVYTFSQTNRGTKTRFWFIDIPVVFLPYAMLLVTMVSNGWDAAL
FT                   VESTGILAAHTYDFLTRIYPTFGGGRNFITVPGFLERYFTEHDPNSGYRGYGTASRAPR
FT                   PAGQPSSASASGSTWGSWTSSSSWNGRGAGRRLG"
     MDVFWAAPPV TRTLTALTLV QSALMYGGLL SFYWAPFLPS LIFSWRPQIY RLVTPFLLTG        60
     PKLGFFFDLY IMYRYGSAAE KSMAPGEFLI YLLFVAFSIM LTAGGYLGAA ILLPPLTMAF       120
     VYTFSQTNRG TKTRFWFIDI PVVFLPYAML LVTMVSNGWD AALVESTGIL AAHTYDFLTR       180
     IYPTFGGGRN FITVPGFLER YFTEHDPNSG YRGYGTASRA PRPAGQPSSA SASGSTWGSW       240
     TSSSSWNGRG AGRRLG                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page