(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE75

PENCW_16.PE75        Location/Qualifiers
FT   CDS             join(167606..167714,167770..167926,167994..168625,
FT                   168685..168911,168965..169261)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946705"
FT                   /orf_name="Pc20g00750"
FT                   /product="Pc20g00750 protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAP85404.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0001831B98"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC6"
FT                   /transl_table=1
FT                   /translation="MAVVKTSEMDYAIKPEASVPSVDTSDWPLLLKNYEKLLVRTGHFT
FT                   PIPAGSSPLSRDLKSYISSGVINLDKPSNPSSHEVVAWMKRILRSEKTGHSGTLDPKVT
FT                   GCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKIPGGEAQFVRALETLTGALFQRPPLI
FT                   SAVKRQLRIRTIHESKNYEFDNERHLGVFWVSCEAGTYIRTLCVHLGLLLGVGAHMQEL
FT                   RRVRSGAMGEGEGMVTLHDVMDAQWVYDNNRDESYLRKVISPLESLLTGYKRIVVKDSA
FT                   VNAVCYGAKLMIPGLLRYEAGIECHEEVVLMTTKGEAIAIGIAQMSTVELTTCDHGVVA
FT                   KVKRCIMERDLYPRRWGLGPTALEKKKMKTAGTLDKYGRPNDATPAQWKSEYKDFNLPI
FT                   TGTAAVAPSAETKTETEAPKVESPEPVKEEVEDKKRKRDGETAEEKAERKKKKKEKKEK
FT                   KERRKSKQDDSDDSD"
     MAVVKTSEMD YAIKPEASVP SVDTSDWPLL LKNYEKLLVR TGHFTPIPAG SSPLSRDLKS        60
     YISSGVINLD KPSNPSSHEV VAWMKRILRS EKTGHSGTLD PKVTGCLIVC IDRATRLVKS       120
     QQGAGKEYVC VIRLHDKIPG GEAQFVRALE TLTGALFQRP PLISAVKRQL RIRTIHESKN       180
     YEFDNERHLG VFWVSCEAGT YIRTLCVHLG LLLGVGAHMQ ELRRVRSGAM GEGEGMVTLH       240
     DVMDAQWVYD NNRDESYLRK VISPLESLLT GYKRIVVKDS AVNAVCYGAK LMIPGLLRYE       300
     AGIECHEEVV LMTTKGEAIA IGIAQMSTVE LTTCDHGVVA KVKRCIMERD LYPRRWGLGP       360
     TALEKKKMKT AGTLDKYGRP NDATPAQWKS EYKDFNLPIT GTAAVAPSAE TKTETEAPKV       420
     ESPEPVKEEV EDKKRKRDGE TAEEKAERKK KKKEKKEKKE RRKSKQDDSD DSD              473
//

If you have problems or comments...

PBIL Back to PBIL home page