(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE77

PENCW_16.PE77        Location/Qualifiers
FT   CDS             join(complement(172515..172740),complement(171294..172264))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946706"
FT                   /orf_name="Pc20g00770"
FT                   /product="Pc20g00770 protein"
FT                   /protein_id="CAP85406.1"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="UniParc:UPI0001831C6E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGC8"
FT                   /transl_table=1
FT                   /translation="MPRNNKKVKNAPPPRPRGPSKPAGLSSYPAKGQQHGNGQKQGNSN
FT                   ANVPKKASMQANQRPIVPFLRKDRILLIGEGDFSFGRSLAKQYKCRNLCATCYDSKEAL
FT                   YDKYPQAPQNVSDILSASAKPKPASDETEKQPEENKSEDQDSTNPSQQTPKVVFSVDAR
FT                   KLGAPTGGGKEIRTGFARRERKRPAWYQQNEPAGPPYQPGGPWDVICFNFPHVGGLSTD
FT                   VNRQVRANQELLVAFFKACVPLVSKPPPLMDAEDDEWVYADGEESDEEDEDEDEEGGEG
FT                   EELGKDDDTTGKGFRTGPGQILVTLFEGEPYTLWNIKDLARHAGLVVVTSFRFPWTSYE
FT                   GYSHARTAGHIEGKDGERGGWRGEDREARMYVFEVKQKEPAKKGGKKRSRDDDSSDSE"
     MPRNNKKVKN APPPRPRGPS KPAGLSSYPA KGQQHGNGQK QGNSNANVPK KASMQANQRP        60
     IVPFLRKDRI LLIGEGDFSF GRSLAKQYKC RNLCATCYDS KEALYDKYPQ APQNVSDILS       120
     ASAKPKPASD ETEKQPEENK SEDQDSTNPS QQTPKVVFSV DARKLGAPTG GGKEIRTGFA       180
     RRERKRPAWY QQNEPAGPPY QPGGPWDVIC FNFPHVGGLS TDVNRQVRAN QELLVAFFKA       240
     CVPLVSKPPP LMDAEDDEWV YADGEESDEE DEDEDEEGGE GEELGKDDDT TGKGFRTGPG       300
     QILVTLFEGE PYTLWNIKDL ARHAGLVVVT SFRFPWTSYE GYSHARTAGH IEGKDGERGG       360
     WRGEDREARM YVFEVKQKEP AKKGGKKRSR DDDSSDSE                               398
//

If you have problems or comments...

PBIL Back to PBIL home page