(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE79

PENCW_16.PE79        Location/Qualifiers
FT   CDS             join(complement(176076..176318),complement(175935..176022),
FT                   complement(175504..175875),complement(175014..175447))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000031183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977340"
FT                   /orf_name="Pc20g00790"
FT                   /product="Pc20g00790 protein"
FT                   /function="nucleotide-sugar transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85408.1"
FT                   /db_xref="GO:0005338"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004689"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI0001831C70"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD0"
FT                   /transl_table=1
FT                   /translation="MAEDKKSDDYTVDMNKVDQGNKEFEAAPPPTPSPRASSTVSNNPA
FT                   FPVLAYCGSSIMMTVMNKYVLSGLDFNLNFLLLCVQSLVCIAAIQTCKSMGLITFRDFN
FT                   TDEARKWFPITLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTNL
FT                   TLFSFGLMVFSSLIAAWADIKHAVESTGDTSSKVSTLNAGYVWMLINCLCTSSYVLGMR
FT                   KRIKLTNFKDFDTMFYNNLLSIPVLIVLTLLVEDWSSANLARNFPEANRDGIFFAMVLS
FT                   GASSVFISYTSAWCVRTTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSVSAIAIGFV
FT                   SGIVYAVAKIKQNSKPRTGVLPTPVSASSQSMRDSLRS"
     MAEDKKSDDY TVDMNKVDQG NKEFEAAPPP TPSPRASSTV SNNPAFPVLA YCGSSIMMTV        60
     MNKYVLSGLD FNLNFLLLCV QSLVCIAAIQ TCKSMGLITF RDFNTDEARK WFPITLLLIG       120
     MIYTGSKALQ FLSIPVYTIF KNLTIILIAY GEVLWFGGSV TNLTLFSFGL MVFSSLIAAW       180
     ADIKHAVEST GDTSSKVSTL NAGYVWMLIN CLCTSSYVLG MRKRIKLTNF KDFDTMFYNN       240
     LLSIPVLIVL TLLVEDWSSA NLARNFPEAN RDGIFFAMVL SGASSVFISY TSAWCVRTTS       300
     STTYSMVGAL NKLPIALSGL IFFDAPVTFP SVSAIAIGFV SGIVYAVAKI KQNSKPRTGV       360
     LPTPVSASSQ SMRDSLRS                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page