(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE8

PENCW_16.PE8         Location/Qualifiers
FT   CDS             join(complement(24727..25296),complement(24501..24669),
FT                   complement(24030..24430))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175137" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946673"
FT                   /orf_name="Pc20g00080"
FT                   /product="Pc20g00080 protein"
FT                   /protein_id="CAP85337.1"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000183182E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER6"
FT                   /transl_table=1
FT                   /translation="MKFSLGLLFAAVAVASSPAKRADAVSVTGSPPGFAYGVTGGGDAT
FT                   PVYPTDVKHLIELLGSDDPQVIIIDKTFDFIGTEGTTKGNICKAYGSFEDGCQSTIDIG
FT                   KGCDGKPSEPYEWDTAGTTGITVQSDKTIIGVGNKGVLLGKGLRIVRASNIIVQNIMIT
FT                   NLNPQLVWGGDAITLSGTSKVWIDHVTTQYTGRVHYVFGHEANAHVTISNSFMNGATNF
FT                   STSCDGQNYWGLELVGADDQITFANNYVYRTSGRSPALSGKTLFHAVNSVWEDNSGHAI
FT                   EGTDDGQGLFEGCVFNNVTQIVGDFVGQLFSSPSATANKECAGYLKRDCVTNIQTNNGD
FT                   QFTNADTKFFSNFAGLNIATASAASAAQASVPTNAGNTL"
     MKFSLGLLFA AVAVASSPAK RADAVSVTGS PPGFAYGVTG GGDATPVYPT DVKHLIELLG        60
     SDDPQVIIID KTFDFIGTEG TTKGNICKAY GSFEDGCQST IDIGKGCDGK PSEPYEWDTA       120
     GTTGITVQSD KTIIGVGNKG VLLGKGLRIV RASNIIVQNI MITNLNPQLV WGGDAITLSG       180
     TSKVWIDHVT TQYTGRVHYV FGHEANAHVT ISNSFMNGAT NFSTSCDGQN YWGLELVGAD       240
     DQITFANNYV YRTSGRSPAL SGKTLFHAVN SVWEDNSGHA IEGTDDGQGL FEGCVFNNVT       300
     QIVGDFVGQL FSSPSATANK ECAGYLKRDC VTNIQTNNGD QFTNADTKFF SNFAGLNIAT       360
     ASAASAAQAS VPTNAGNTL                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page