(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE83

PENCW_16.PE83        Location/Qualifiers
FT   CDS             183895..184422
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824095"
FT                   /orf_name="Pc20g00830"
FT                   /product="Pc20g00830 protein"
FT                   /protein_id="CAP85412.1"
FT                   /db_xref="UniParc:UPI0001831C73"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD3"
FT                   /transl_table=1
FT                   /translation="MNLNGLSWPTKHLHASTRNGSTWGYVIYRTTYTPHSNAAFLRIIE
FT                   LLNSYMKQGLYSECVSSENNTSMDTDLTTYHEIWAQHRPIVMNHPRFDGASIDSIRAHF
FT                   RCWVGQQEDQGYCTQYRMCMVIDEESLQTLLDAPPPQESSDEKIIDPMRHVKVVTLLPD
FT                   SDDDEFDSFLGG"
     MNLNGLSWPT KHLHASTRNG STWGYVIYRT TYTPHSNAAF LRIIELLNSY MKQGLYSECV        60
     SSENNTSMDT DLTTYHEIWA QHRPIVMNHP RFDGASIDSI RAHFRCWVGQ QEDQGYCTQY       120
     RMCMVIDEES LQTLLDAPPP QESSDEKIID PMRHVKVVTL LPDSDDDEFD SFLGG            175
//

If you have problems or comments...

PBIL Back to PBIL home page